pereae-PDAT1

Persea americana (Avocado) phospholipid:diacylglycerol acyltransferase 1 (PDAT1) PaPDAT1

Comment

Relationship

Family : PC-sterol_acyltransferase

Block : L

Position in NCBI Life Tree : Persea americana

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MLRRRKATESEKKPESSDENKTDKIDSEPDKEEEKEKKKS
RAETEDKRNK HQHHRWSCVDSCCWFIGCICSIWWFLLFL
YNAMPASFPQYVTEAITGPLP DPPGVKLQKEGLSVKHPV
LFVPGIVTGGLELWEGHHCADGLFRKRLWGGT FGEVYKR
PLCWVEHMSLDNETGLDPSGIRVRPVTGLVAADYFAPGYF
VWA VLIANLARIGYEEKTMYMAAYDWRISFQNTEVRDQS
LSRIKSNIELMVAT NDGKKVVVIPHSMGVLYFLHFMKWV
EAPAPMGGGGGPDWCAKHIKAVMNI GGPFLGVPKAAAGL
FSAEARDVAVARAIAPGVLDSDYLGLQTLQHVMRMT RTW
DSTMSMIPKGGDTIWGGLDWSPEEGYDCSPKKQKNNDTHI
SADNGTV SVSSQSIHMNYGRIISFGKDVAEAHSSQIEQI
EFRGAVKGNKLAKSNVSC DIWTEYHEMGLGGIKAVADYK
VYTAGSLLDLLNFVAPKMMQRGSAHFSYG IAEDLDDPQY
EHYKYWSNPLETKLPNAPDMEIYSMYGVGIPTERSYIYKA
SSPTECYIPFQIDTSAEGGKGGSCLQGGVYSVDGDETVP
VLSAGYMCAKG WRGKTRFNPSEIRTFIREYNHAPPSTLL
EGRGTQSGAHVDIMGNFALIED VIRVAAGATGEDLGGDQ
VYSDIFKWSEKIKLEL

References

Title : Acyl-CoA-dependent and acyl-CoA-independent avocado acyltransferases positively influence oleic acid content in nonseed triacylglycerols - Behera_2022_Front.Plant.Sci_13_1056582
Author(s) : Behera J , Rahman MM , Shockey J , Kilaru A
Ref : Front Plant Sci , 13 :1056582 , 2022
Abstract : Behera_2022_Front.Plant.Sci_13_1056582
ESTHER : Behera_2022_Front.Plant.Sci_13_1056582
PubMedSearch : Behera_2022_Front.Plant.Sci_13_1056582
PubMedID: 36714784
Gene_locus related to this paper: pereae-PDAT1