picsi-a9nsc2

Picea sitchensis (Sitka spruce) (Pinus sitchensis) Putative uncharacterized protein

Comment

Relationship

Family : Hydroxynitrile_lyase

Block : X

Position in NCBI Life Tree : Picea sitchensis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MMALQWRWTVVTLSVMLLLVSIHLQEGEGRQQHFVLIHGL
GHVAWCWYKI VTLLKQKGHRVAALDLTSNGINRAASTDQ
VNSIAHYAEPLLEYIRNLGNN EKVTLVGHSLAGCPLSYA
MELYPSKITKAIFVAAFTPRNNQSFLSSANPK SFARLVE
NGVLVLNVKADSELPTSASLVLDHVKSYLYNESPDEDANL
AQS LLTPTPFPVSVEFLKLSEERYESIRRFYIMLMKDRL
FPPEYQEYSIAQNP PEKIFKMHASDHSPFFSQPQQLCNL
LVHIATL

References

Title : A conifer genomics resource of 200,000 spruce (Picea spp.) ESTs and 6,464 high-quality, sequence-finished full-length cDNAs for Sitka spruce (Picea sitchensis) - Ralph_2008_BMC.Genomics_9_484
Author(s) : Ralph SG , Chun HJ , Kolosova N , Cooper D , Oddy C , Ritland CE , Kirkpatrick R , Moore R , Barber S , Holt RA , Jones SJ , Marra MA , Douglas CJ , Ritland K , Bohlmann J
Ref : BMC Genomics , 9 :484 , 2008
Abstract : Ralph_2008_BMC.Genomics_9_484
ESTHER : Ralph_2008_BMC.Genomics_9_484
PubMedSearch : Ralph_2008_BMC.Genomics_9_484
PubMedID: 18854048
Gene_locus related to this paper: picgl-emb8 , picsi-a9nkq4 , picsi-a9nkw1 , picsi-a9nln3 , picsi-a9nlt8 , picsi-a9nng6 , picsi-a9np75 , picsi-a9np95 , picsi-a9nqw9 , picsi-a9nsc2 , picsi-a9nsf2 , picsi-a9nux2 , picsi-a9nvj5 , picsi-a9nvl0 , picsi-a9nwa5 , picsi-a9nws5 , picsi-a9nwz2 , picsi-a9nyx6 , picsi-a9nzz3 , picsi-a9p0a1 , picsi-a9p0c3 , picsi-a9p1m0 , picsi-a9p066 , picsi-a9p157 , picsi-a9nu19