pig-a0a286zjp4

Sus scrofa (Pig). Lipase I

Comment

Relationship

Family : Phospholipase

Block : L

Position in NCBI Life Tree : Sus scrofa

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MNFRISFVVNLSVSFTFIRFQMRIYIFLSLMCWAGSENKG
PCLEFSQLSV KDSFRDLFNPQMEIFLILYTRKNPSCAEP
LFEQDNSLSANFNTSKKTVWL IHGYRPMGSTPSWLRNFV
RILLNQDMNIIIVDWNRGATTFLYSRAVKNTR KVAVSLS
RYIQNLLKHGASLDSFHFIGVSLGAHISGFVGKIFQGQVG
RIT GLDPAGPQFSGKPSNGRLDYTDANFVDVIHTDTNGL
GIKEPLGHIDFYPN GGKKQPGCPKSIFAGIEFIKCDHQR
AVYLFMAALETSCNFISFPCHSYKD YKSGSCVDCDNFKE
KSCPKLGYQTELWKDILKERIENRSLRTTVFLDTVQ TNP
FCTYYFVLSVIVLDKTMKDGYITFKLLNQLGMVEEPRLYE
KNKLFYK RQEVKILAQFLNDVVNISSISLAYFQSSNQQC
SKCKYTIRRLMLKSLTYP ERPPLCIYNFVLEESREIVLS
PNICTLTEI

References

No reference