pig-a0a287aen7

Sus scrofa (Pig). Uncharacterized protein

Comment

Relationship

Family : Neuroligin

Block : C

Position in NCBI Life Tree : Sus scrofa

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MSRPQGLVWLPLVFTPVCVMLHAKVLLCITALAIKFTLID
SQAQYPVVNT NYGKIRGLRTPLPNEILGPVEQYLGVPYA
SPPTGERRFQPPEPPSSWTGI RNATQFAAVCPQHLDERS
LLHDMLPIWFTANLDTLMTYVQDQNEDCLYLN IYVPTED
GANTKKNADDISSNDRGEDEDIHDQNSKKPVMVYIHGGSY
MEG TGNMIDGSILASYGNVIVITINYRLGILGFLSTGDQ
AAKGNYGLLDQIQA LRWIEENVGAFGGDPKRVTIFGSGA
GASCVSLLTLSHYSEGLFQKAIIQS GTALSSWAVNYQPA
KYTRILADRVGCNMLDTTDMVDCLRNKNYKELIQQT ITP
ATYHISFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQ
GEGLKFV DGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEG
KDTLRETIKFMYTDWADK ENPETRRKTLVALFTDHQWVA
PAVATADLHAQYGSPTYFYAFYHHCQSEM KPSWADSAHG
DEVPYVFGIPMIGPTELFSCNFSKNDVMLSAVVMTYWTNF
AKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLY
LHIGLKPRVRD HYRATKVAFWLELVPHLHNLNEIFQYVS
TTTKVPPPDMTSFPYGTRRSPA KIWPTTKRPAITPANNP
KHSKDPHKTGPEDTTVLIETKRDYSTELSVTIA VGASLL
FLNILAFAALYYKKDKRRHETHRRPSPQRNTTNDIAHMQN
EEIM SLQMKQLEHDHECESLQAHDTLRLTCPPDYTLTLR
RSPDDIPLMTPNTIT MIPSTLTGMQPLHTFNTFSGGQNS
SNLPHGHSTTRV

References

No reference