popto-CSE14

Populus tomentosa (Chinese white poplar) Caffeoyl shikimate esterase 14 PoptoCSE14

Comment

"Other strains: Populus tomentosa (Chinese white poplar)\; Populus alba (White poplar)"

Relationship

Family : Monoglyceridelipase_lysophospholip

Block : X

Position in NCBI Life Tree : Populus tomentosa

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MFNKKNMKIFTQSWRPDSTSQPKGIVAMVHGYSSESSWLN
ELTAVAIAKA GFLVCALDLQGHGYSDGLAGHIPNIQYVV
SDCIKFFDSVRASNPKLPAFL YGESLGGAISILICLKQG
YAWDGLILSGAMCGISGKFKPMWPLEKLLPLA ALFAPTW
KVVVSKPVSSRSYKEEWKRRLVANNPNRRNSGKPPAATAL
EFL RVSEYIRMHCCDLRVPFVMVHGEDDFVCDYRSASFV
HESASSKDKTLKIF PGMWHVLIGEPKENVELVFETILSW
LEDHAAKAKNTKTITS

References

Title : Systematic Analysis and Biochemical Characterization of the Caffeoyl Shikimate Esterase Gene Family in Poplar - Wang_2021_Int.J.Mol.Sci_22_13366
Author(s) : Wang X , Chao N , Zhang A , Kang J , Jiang X , Gai Y
Ref : Int J Mol Sci , 22 : , 2021
Abstract : Wang_2021_Int.J.Mol.Sci_22_13366
ESTHER : Wang_2021_Int.J.Mol.Sci_22_13366
PubMedSearch : Wang_2021_Int.J.Mol.Sci_22_13366
PubMedID: 34948162
Gene_locus related to this paper: poptr-CSE16 , poptr-CSE17 , popto-CSE14 , poptr-CSE6 , poptr-CSE12 , poptr-CSE8 , poptr-CSE5 , poptr-CSE1 , poptr-CSE3 , poptr-CSE15 , arath-F14G24.3 , poptr-b9gwn9 , poptr-b9hll5 , poptr-b9huf0 , poptr-b9n233