pruav-a0a6p5tmj7

Prunus avium (Cherry) (Cerasus avium). Uncharacterized protein LOC110769222

Comment

Relationship

Family : TGL-GrainShapeFactor

Block : X

Position in NCBI Life Tree : Prunus avium

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MPGCFSFTASRDRCFRYYFSSHGLKSTTTDLGEGTIMHCW
VPKSHSQSKP TLLLIHGIGANAMWQWHEFVAPLAARFNL
YIPDLVFFGDSFSTRPDRSET FQAQCVVGLLEAHGVKKM
SVAGISYGGFVAYSMAAQFGERIERLVLCCAG VCLEEKD
MEKGMFQVRSAEEAVSILLPQRPQQVRQLLKISFHKPVKN
LPS CFLNDFIEVMCTEHLQERKGLIQALHKDRKLSDLPK
ISHPTLIIWGEHDL VFPLELGHRLKRQIGESSQLVILKN
AGHAINAEKPKEMYKHMKSFLIDPL PPPKQESHSNGRKV
D

References

Title : The genome sequence of sweet cherry (Prunus avium) for use in genomics-assisted breeding - Shirasawa_2017_DNA.Res_24_499
Author(s) : Shirasawa K , Isuzugawa K , Ikenaga M , Saito Y , Yamamoto T , Hirakawa H , Isobe S
Ref : DNA Research , 24 :499 , 2017
Abstract : Shirasawa_2017_DNA.Res_24_499
ESTHER : Shirasawa_2017_DNA.Res_24_499
PubMedSearch : Shirasawa_2017_DNA.Res_24_499
PubMedID: 28541388
Gene_locus related to this paper: pruav-a0a6p5tfl8 , pruav-a0a6p5sn52 , pruav-a0a6p5tmj7