pyrko-q5jd37

Pyrococcus kodakaraensis (Thermococcus kodakaraensis) prolyl endopeptidase

Comment

Relationship

Family : S9N_PPCE_Peptidase_S9

Block : X

Position in NCBI Life Tree : Pyrococcus kodakaraensis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MEDPYIWMENLQDERVLKLVEEENRRFREFIGKLSDELFP
EVWGLYSLPT LHSARLTEKGIIAVFKERDRQVIRWLNGD
VIVDSKALEAEIGDEVLLQGF TADGKGKRLAYSFSIGGA
DEGVTRIIDLESGELIDELRPSVWNVTFLENG YYFSRFY
RHGETPDGVKAPAVRLFWKDESGERMVFGQGLGSGYFMGL
RKS TDGKWAMLTVTFGWNRADIYIGPIEAPDRWEKVYSA
DVPAEPIDVVNGRL YILTREGKGLGKVIAIEGEKTIEVV
PEGEFPLEWAVIVGDRILAGRLVHA SHRLEVYSLNGEKL
DEIAFDLPGSVYPLDSDGKKALLRYESFTVPYRLYQ FDG
ELKLIGTQEVEGKFTVEEDFATSKDGTKIHYFHVKGEKDD
KKVWVFG YGGFNISLTPRFFPQAIPFIRRGGTFAMANLR
GGSEYGEEWHRAGMRENK QNVFDDFIAVLEKLKKEGYRI
AAWGRSNGGLLVSATLTQRPDVMDAALIG YPVIDMLRFH
KLYIGSVWIPEYGNPDDPKDREFLLKYSPYHNVDPNKRYP
PTLIYTGLHDDRVHPAHALKFFMKLREVGAPVYLRVETK
SGHMGASPETR ARELTDLLAFVVKTLR

References

Title : Complete genome sequence of the hyperthermophilic archaeon Thermococcus kodakaraensis KOD1 and comparison with Pyrococcus genomes - Fukui_2005_Genome.Res_15_352
Author(s) : Fukui T , Atomi H , Kanai T , Matsumi R , Fujiwara S , Imanaka T
Ref : Genome Res , 15 :352 , 2005
Abstract : Fukui_2005_Genome.Res_15_352
ESTHER : Fukui_2005_Genome.Res_15_352
PubMedSearch : Fukui_2005_Genome.Res_15_352
PubMedID: 15710748
Gene_locus related to this paper: pyrko-q5jd37 , pyrko-q5jdq6 , pyrko-q5jf12 , pyrko-q5jh23 , pyrko-q5jhc8 , pyrko-q5jie9