S9N_PPCE_Peptidase_S9
Relationship
Comment
prolyl oligopeptidase (EC 3.4.21.26) (also called post-proline cleaving enzyme PPCE, Prolyl endopeptidase PE, prolyl oligopeptidase POP). Prolyl oligopeptidases are either located in the cytosol or they are membrane bound, where they cleave peptide bonds with prolyl P1 specificities (but cleavage of alanyl bonds has been detected). The proline must adopt a trans con- figuration within the chain. Peptides of up to 30 residues are cleaved. N-terminal domain is a 7-bladed beta-propeller
Database
Interpro : IPR004106 Peptidase S9A\/B\/C, oligopeptidase, N-terminal beta-propeller , IPR001375 Peptidase_S9
PIRSF : No PIRSF
Pdoc : No Pdoc
Pfam : PF00326 Peptidase_S9 , PF02897 Peptidase_S9_N
Prints : No Print
EC Number : No EC Number
Sequences
| Peptide in | Fasta |
| Nucleotide in | Fasta |
| Alignment with Multalin | Text only |
| Seed alignment with MAFFT | No colour / coloured with Mview |
| Alignment with MAFFT | No colour / coloured with Mview |
| Dendrogram | The dnd file |
| Structure | Name | Proteins |
|---|---|---|
| 1E5T | Prolyl oligopeptidase from C255T\/Q397C\/K684M pig mutant | pig-ppce |
| 1E8M | Prolyl oligopeptidase from pig brain mutant covalently bound Z pro prolinal | pig-ppce |
| 1E8N | Prolyl oligopeptidase from pig brain mutant covalently bound octapeptide | pig-ppce |
| 1H2W | Prolyl Oligopeptidase From Porcine Brain | pig-ppce |
| 1H2X | Prolyl Oligopeptidase From Porcine Brain, Y473F Mutant | pig-ppce |
| 1H2Y | Prolyl Oligopeptidase From Porcine Brain, Y473F Mutant With Covalently Bound Inhibitor Z-Pro-Prolinal | pig-ppce |
| 1H2Z | Prolyl Oligopeptidase From Porcine Brain, S554A Mutant With Bound Peptide Ligand Suc-Gly-Pro | pig-ppce |
| 1O6F | Prolyl Oligopeptidase From Porcine Brain, D641A Mutant With Bound Peptide Ligand Suc-Gly-Pro | pig-ppce |
| 1O6G | Prolyl Oligopeptidase From Porcine Brain, D641N Mutant With Bound Peptide Ligand Suc-Gly-Pro | pig-ppce |
| 1QFM | Prolyl oligopeptidase from pig | pig-ppce |
| 1QFS | Prolyl oligopeptidase with covalently bound inhibitor Z-pro-prolinal from pig | pig-ppce |
| 1UOO | Prolyl Oligopeptidase From Porcine Brain, S554A Mutant With Bound Peptide Ligand Gly-Phe-Arg-Pro | pig-ppce |
| 1UOP | Prolyl Oligopeptidase From Porcine Brain, S554A Mutant With Bound Peptide Ligand Gly-Phe-Glu-Pro | pig-ppce |
| 1UOQ | Prolyl Oligopeptidase From Porcine Brain, S554A Mutant With Bound Peptide Ligand Glu-Phe-Ser-Pro | pig-ppce |
| 1VZ2 | Prolyl oligopeptidase from porcine brain Y73C\/V427C\/C255T mutant | pig-ppce |
| 1VZ3 | Prolyl oligopeptidase from porcine brain T597C mutant | pig-ppce |
| 1YR2 | Prolyl endopeptidase from Sphingomonas capsulata open configuration | sphca-Q9ZNM8 |
| 2BKL | Prolyl endopeptidase from Myxococcus xanthus inhibited by Z-Ala_prolinal closed form | myxxa-PEP |
| 2XDW | Inhibition of Prolyl Oligopeptidase with a Synthetic Unnatural Dipeptide | pig-ppce |
| 3DDU | Prolyl Oligopeptidase with GSK552 DB07148 | human-PREP |
| 3EQ7 | Prolyl oligopeptidase complexed with R-Pro-(decarboxy-Pro)-Type inhibitors 1 | pig-ppce |
| 3EQ8 | Prolyl oligopeptidase complexed with R-Pro-(decarboxy-Pro)-Type inhibitors 2 | pig-ppce |
| 3EQ9 | Prolyl oligopeptidase complexed with R-Pro-(decarboxy-Pro)-Type inhibitors 3 | pig-ppce |
| 3IUJ | Aeromonas punctata Prolyl Endopeptidase apPEP_WT2 opened state | aerpu-PEP |
| 3IUL | Aeromonas punctata Prolyl Endopeptidase apPEP_WT1 opened state | aerpu-PEP |
| 3IUM | Aeromonas punctata Prolyl Endopeptidase apPEP_WTX opened state | aerpu-PEP |
| 3IUN | Aeromonas punctata Prolyl Endopeptidase apPEP_D622N opened state | aerpu-PEP |
| 3IUQ | Aeromonas punctata Prolyl Endopeptidase apPEP_D622N+PP closed state | aerpu-PEP |
| 3IUR | Aeromonas punctata Prolyl Endopeptidase apPEP_D266Nx+H2H3 opened state | aerpu-PEP |
| 3IVM | Aeromonas punctata Prolyl Endopeptidase apPEP_WT+PP closed state | aerpu-PEP |
| 3MUN | Aeromonas punctata Prolyl Endopeptidase APPEP_PEPCLOSE closed state | aerpu-PEP |
| 3MUO | Aeromonas punctata Prolyl Endopeptidase APPEP_PEPCLOSE+PP closed state | aerpu-PEP |
| 4AMY | Prolyl Oligopeptidase from porcine brain with a covalently bound inhibitor IC-1 | pig-ppce |
| 4AMZ | Prolyl Oligopeptidase from porcine brain with a covalently bound inhibitor IC-2 | pig-ppce |
| 4AN0 | Prolyl Oligopeptidase from porcine brain with a covalently bound inhibitor IC-3 | pig-ppce |
| 4AN1 | Prolyl Oligopeptidase from porcine brain with a covalently bound inhibitor IC-4 | pig-ppce |
| 4AX4 | Prolyl Oligopeptidase from porcine brain, H680A mutant | pig-ppce |
| 4BCB | Prolyl Oligopeptidase from porcine brain with a covalently bound P2- substituted N-acyl-prolylpyrrolidine inhibitor 1 | pig-ppce |
| 4BCC | Prolyl Oligopeptidase from porcine brain with a covalently bound P2-substituted N-acyl-prolylpyrrolidine inhibitor 2 | pig-ppce |
| 4BCD | Prolyl Oligopeptidase from porcine brain with a non-covalently bound P2- substituted N-acyl-prolylpyrrolidine inhibitor 3 | pig-ppce |
| 4HVT | Structure of a Post-proline cleaving enzyme from Rickettsia typhi | ricty-q68xj3 |
| 5N4B | Prolyl oligopeptidase B from Galerina marginata bound to 25mer macrocyclization substrate - S577A mutant | 9agar-h2e7q8 |
| 5N4C | Prolyl oligopeptidase B from Galerina marginata bound to 35mer hydrolysis and macrocyclization substrate - S577A mutant | 9agar-h2e7q8 |
| 5N4D | Prolyl oligopeptidase B from Galerina marginata bound to 25mer macrocyclization substrate - D661A mutant | 9agar-h2e7q8 |
| 5N4E | Prolyl oligopeptidase B from Galerina marginata bound to 35mer hydrolysis and macrocyclization substrate - H698A mutant | 9agar-h2e7q8 |
| 5N4F | Prolyl oligopeptidase B from Galerina marginata - apo protein | 9agar-h2e7q8 |
| 5O3U | Structural characterization of the fast and promiscuous macrocyclase from plant - PCY1-S562A bound to Presegetalin F1 | 9cary-r4p353 |
| 5O3V | Structural characterization of the fast and promiscuous macrocyclase from plant Gypsophila vaccaria (Cow soapwort) - PCY1-S562A bound to Presegetalin B1 | 9cary-r4p353 |
| 5O3W | Structural characterization of the fast and promiscuous macrocyclase from plant Gypsophila vaccaria (Cow soapwort) - PCY1-S562A bound to Presegetalin A1 | 9cary-r4p353 |
| 5O3X | Structural characterization of the fast and promiscuous macrocyclase from plant Gypsophila vaccaria (Cow soapwort) - apo PCY1 | 9cary-r4p353 |
| 5T88 | Prolyl oligopeptidase from Pyrococcus furiosus | pyrfu-Q51714 |
| 5UW3 | Gypsophila vaccaria (Cow soapwort) macrocyclase PCY1 involved in the biosynthesis of RiPP cyclic peptide in complex with follower peptide | 9cary-r4p353 |
| 5UW5 | Gypsophila vaccaria (Cow soapwort) macrocyclase PCY1 involved in the biosynthesis of RiPP cyclic peptide PCY1 H695A Variant in Complex with Follower Peptide | 9cary-r4p353 |
| 5UW6 | Gypsophila vaccaria (Cow soapwort) macrocyclase PCY1 involved in the biosynthesis of RiPP cyclic peptide in complex with follower peptide and covalent inhibitor ZPP | 9cary-r4p353 |
| 5UW7 | PCY1 Y481F Variant in Complex with Follower Peptidee | 9cary-r4p353 |
| 5UZW | PCY1 G696Insertion Variant in Complex with Follower Peptide and the Covalent Inhibitor ZPP Z-Pro-Prolinal | 9cary-r4p353 |
| 6CAN | Prolyl oligopeptidase mutant S477C from Pyrococcus furiosus | pyrfu-Q51714 |
| 6JCI | Crystal structure of Prolyl Endopeptidase from Haliotis discus hannai with SUAM-14746 | haldh-a0a1x9t5x9 |
| 6JYM | Crystal structure of Prolyl Endopeptidase from Haliotis discus hannai | haldh-a0a1x9t5x9 |
| 7VGB | Crystal structure of apo prolyl oligopeptidase from Microbulbifer arenaceous | 9gamm-MaPOP |
| 7VGC | Crystal structure of prolyl oligopeptidase from Microbulbifer arenaceous complex with a transition state analog inhibitor ZPR | 9gamm-MaPOP |
| 7Y1X | Crystal structure of prolyl oligopeptidase from Microbulbifer arenaceous complex with PEG400 and MES | 9gamm-MaPOP |
| 7ZAZ | Omphalotus olearius macrocyclase OphP with ZPP | ompol-OphP |
| 7ZB0 | Omphalotus olearius macrocyclase OphP with 15mer | ompol-OphP |
| 7ZB1 | Omphalotus olearius macrocyclase OphP S580A with 18mer | ompol-OphP |
| 7ZB2 | Omphalotus olearius macrocyclase OphP S580A apo | ompol-OphP |
| Gene_locus | Name | Species |
|---|---|---|
| 9agar-h2e7q8 |  Galerina marginata Prolyl oligopeptidase POPB |
Galerina marginata |
| 9bact-q26h93 | Flavobacteria bacterium BBFL7 prolyl endopeptidase serine protease (EC 3.4.21.26) | Flavobacteria bacterium BBFL7 |
| 9cary-r4p353 | Gypsophila vaccaria Prolyl endopeptidase Pcy1 |
Gypsophila vaccaria |
| 9chlb-q43eh9 | Chlorobium phaeobacteroides DSM 266 prolyl oligopeptidase precursor (EC 3.4.21.26) | Chlorobium phaeobacteroides DSM 266 |
| 9chlb-q4alz1 | Chlorobium phaeobacteroides BS1 prolyl oligopeptidase precursor (EC 3.4.21.26) | Chlorobium phaeobacteroides BS1 |
| 9eury-b7r0s6 | Thermococcus sp. AM4 Prolyl endopeptidase | Thermococcus sp. AM4 |
| 9flao-q1vxy2 | Psychroflexus torquis (strain ATCC 700755 \/ ACAM 623) prolyl endopeptidase | Psychroflexus torquis ATCC 700755 |
| 9flao-q1vz51 | Psychroflexus torquis (strain ATCC 700755 \/ ACAM 623) prolyl oligopeptidase family protein | Psychroflexus torquis ATCC 700755 |
| 9gamm-MaPOP | Microbulbifer arenaceous prolyl oligopeptidase MaPOP |
Microbulbifer arenaceous |
| 9gamm-q2wwt8 | Shewanella sp. W3-18-1 prolyl oligopeptidase precursor (EC 3.4.21.26) | Shewanella sp. W3-18-1 |
| 9gamm-q2x3h7 | Shewanella sp. W3-18-1 and Shewanella baltica OS155 prolyl oligopeptidase precursor (EC 3.4.21.26) | Shewanella baltica OS155 |
| 9gamm-q3nyp6 | Shewanella denitrificans OS217 prolyl oligopeptidase precursor (EC 3.4.21.26) | Shewanella denitrificans OS217 |
| 9gamm-q3qdu6 | Shewanella amazonensis SB2B prolyl oligopeptidase precursor (EC 3.4.21.26) | Shewanella amazonensis SB2B |
| 9gamm-q3qef8 | Shewanella amazonensis SB2B prolyl oligopeptidase precursor (EC 3.4.21.26) | Shewanella amazonensis SB2B |
| 9gamm-q6ivm6 | uncultured gamma proteobacterium eBACHOT4E07 predicted prolyl endopeptidase | uncultured gamma proteobacterium eBACHOT4E07 |
| 9gamm-q6q963 | uncultured marine gamma proteobacterium EBAC20E09 predicted prolyl endopeptidase (fragment) | uncultured marine gamma proteobacterium EBAC20E09 |
| 9hemi-e1u339 | Eurygaster integriceps Prolyl endopeptidase salivary glutenase spPEP | Eurygaster integriceps |
| 9myco-q1tu32 | Mycobacterium sp. (strains JLS\; KMS MCS) prolyl oligopeptidase (EC 3.4.21.26) | Mycobacterium sp. JLS |
| 9sphn-q1n9q7 | Sphingomonas sp. SKA58 prolyl oligopeptidase family protein | Sphingomonas sp. SKA58 |
| 9sphn-q1nec1 | Sphingomonas sp. SKA58 prolyl oligopeptidase | Sphingomonas sp. SKA58 |
| 9sphn-q2n8z0 | Erythrobacter litoralis HTCC2594 prolyl oligopeptidase family protein | Erythrobacter litoralis HTCC2594 |
| 9sphn-q3v961 | Sphingopyxis alaskensis RB2256 prolyl oligopeptidase precursor (EC 3.4.21.26) | Sphingopyxis alaskensis RB2256 |
| acib4-b5ifw4 | Aciduliprofundum boonei (strain DSM 19572 \/ T469) Prolyl oligopeptidase | Aciduliprofundum boonei |
| acice-q2dz67 | Acidothermus cellulolyticus 11B prolyl oligopeptidase (EC 3.4.21.26) | Acidothermus cellulolyticus 11B |
| aerhy-ppce | Aeromonas hydrophila prolyl endopeptidase | Aeromonas hydrophila |
| aerpu-PEP | Aeromonas punctata subsp. punctata prolyl endopeptidase (EC 3.4.21.26) |
Aeromonas punctata |
| ailme-d2h5r9 | Ailuropoda melanoleuca (Giant panda) Putative uncharacterized protein | Ailuropoda melanoleuca |
| amabi-popa | Amanita bisporigera (Destroying angel). Prolyl oligopeptidase A | Amanita bisporigera |
| amabi-popb | Amanita bisporigera (Destroying angel). Toxin-processing prolyl oligopeptidase | Amanita bisporigera |
| amaex-AePOPB | Amanita exitialis (Guangzhou destroying angel) Prolyl endopeptidase | Amanita exitialis |
| anasp-ALL2533 | Anabaena sp. (strain PCC 7120) Anabaena variabilis (strain ATCC 29413 \/ PCC 7937) prolyl endopeptidase | Anabaena variabilis |
| anoga-q7pvv8 | Anopheles gambiae str. PEST ensangp00000016749 (fragment) | Anopheles gambiae |
| arath-AT1G76140 | Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) AT1G76140 t23e18.8 | Arabidopsis thaliana |
| arath-F14O10.2 | Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress), AT1G20380 f14o10.2 protein | Arabidopsis thaliana |
| arts2-a0jsq4 | Arthrobacter sp. (strain FB24) prolyl oligopeptidase,active site region n-terminal beta-propeller | Arthrobacter sp. FB24 |
| bdeba-q6mhs4 | Bdellovibrio bacteriovorus prolyl oligopeptidase family protein precursor | Bdellovibrio bacteriovorus |
| bora1-q2kti1 | Bordetella avium (strain 197N) putative prolyl endopeptidase | Bordetella avium |
| bovin-ppce | Bos taurus (Bovine) (PE) | Bos taurus |
| braja-BLL1016 | Bradyrhizobium japonicum bll1016 protein | Bradyrhizobium japonicum |
| brasb-a5e9x2 | Bradyrhizobium sp. probable peptidase | Bradyrhizobium sp. BTAi1 |
| burca-q1bhv9 | Burkholderia cenocepacia prolyl oligopeptidase,active site and n-terminal beta-propeller | Burkholderia cenocepacia |
| burcm-q0bdn4 | Burkholderia ambifaria (Burkholderia cepacia) prolyl oligopeptidase, n-terminal beta-propeller | Burkholderia ambifaria AMMD |
| burma-q62cg5 | Burkholderia mallei (Pseudomonas mallei) Burkholderia pseudomallei (Pseudomonas pseudomallei), Burkholderia thailandensis, prolyl oligopeptidase family protein | Burkholderia mallei |
| burvi-q4bjc3 | Burkholderia vietnamiensis G4 prolyl oligopeptidase, n-terminal beta-propeller | Burkholderia vietnamiensis G4 |
| canfa-f1phx2 | Canis lupus familiaris (Dog) (Canis familiaris) Uncharacterized protein | Canis lupus familiaris |
| caucr-CC3687 | Caulobacter crescentus prolyl oligopeptidase family protein | Caulobacter crescentus |
| caucr-CC3688 | Caulobacter crescentus prolyl oligopeptidase family protein | Caulobacter crescentus |
| chick-q5zmi7 | Gallus gallus (Chicken) hypothetical protein | Gallus gallus |
| chll2-b3edc5 | Chlorobium limicola (strain DSM 245 \/ NBRC 103803) prolyl oligopeptidase precursor (EC 3.4.21.26) | Chlorobium limicola DSM 245 |
| chlte-CT1301 | Chlorobium tepidum prolyl oligopeptidase family protein | Chlorobium tepidum |
| chlvi-q3ggi7 | Prosthecochloris vibrioformis DSM 265 prolyl oligopeptidase precursor (EC 3.4.21.26) | Prosthecochloris vibrioformis DSM 265 |
| chrvo-q7nq34 | Chromobacterium violaceum prolyl endopeptidase (EC 3.4.21.26) | Chromobacterium violaceum |
| chrvo-q7nsc4 | Chromobacterium violaceum prolyl oligopeptidase family protein | Chromobacterium violaceum |
| colp3-q48aq9 | Colwellia psychrerythraea (strain 34H \/ ATCC BAA-681) (Vibrio psychroerythus) prolyl endopeptidase (EC 3.4.21.26) | Colwellia psychrerythraea |
| cordi-q6njn4 | Corynebacterium diphtheriae putative prolyl oligopeptidase family protein | Corynebacterium diphtheriae |
| coref-CE0354 | Corynebacterium efficiens putative peptidase | Corynebacterium efficiens |
| corgl-CGL0340 | Corynebacterium glutamicum (Brevibacterium flavum) serine proteases of the peptidase family s9a (EC 3.4.21.26) | Corynebacterium glutamicum |
| crowt-q4c6t5 | Crocosphaera watsonii prolyl oligopeptidase (EC 3.4.21.26) | Crocosphaera watsonii |
| cryne-q5kat4 | Cryptococcus neoformans (Filobasidiella neoformans) (and var. neoformans B-3501A) prolyl endopeptidase, putative (EC 3.4.21.26) | Cryptococcus neoformans |
| cryne-q5kav3 | Cryptococcus neoformans (Filobasidiella neoformans) (and var. neoformans B-3501A) hypothetical protein | Cryptococcus neoformans |
| cytjo-q1xjz5 | Flavobacterium johnsoniae UW101 prolyl oligopeptidase precursor (EC 3.4.21.26) | Flavobacterium johnsoniae UW101 |
| cytjo-q1xv98 | Flavobacterium johnsoniae UW101 prolyl oligopeptidase precursor (EC 3.4.21.26) | Flavobacterium johnsoniae UW101 |
| danre-q503e2 | Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical protein zgc:110670 | Danio rerio |
| deira-DR2503 | Deinococcus radiodurans prolyl endopeptidase | Deinococcus radiodurans |
| dicdi-DPOA | Dictyostelium discoideum (Slime mold) prolyl oligopeptidase (EC 3.4.21.26) | Dictyostelium discoideum |
| drome-CG2528 | Drosophila melanogaster (Fruit fly) cg2528 protein | Drosophila melanogaster |
| drome-CG5355 | Drosophila melanogaster (Fruit fly) cg5355 Prolyl endopeptidase | Drosophila melanogaster |
| elimr-ppcf | Elizabethkingia miricola (Chryseobacterium miricola) endopeptidase) (pse) (post-proline cleaving enzyme) (pe) | Elizabethkingia miricola |
| flame-ppce | Flavobacterium meningosepticum prolyl endopeptidase | Flavobacterium meningosepticum |
| frasn-A8L5U7 | Frankia sp. EAN1pec prolyl oligopeptidase (EC 3.4.21.26) | Frankia sp. EAN1pec |
| galm3-popa | Galerina marginata (strain CBS 339.88). Prolyl oligopeptidase A | Galerina marginata |
| glovi-q7nga2 | Gloeobacter violaceus prolyl endopeptidase | Gloeobacter violaceus |
| glovi-q7nmt4 | Gloeobacter violaceus prolyl endopeptidase | Gloeobacter violaceus |
| glovi-q7nmz0 | Gloeobacter violaceus prolyl endopeptidase | Gloeobacter violaceus |
| gluox-q5ft19 | Gluconobacter oxydans (Gluconobacter suboxydans) prolyl oligopeptidase family protein (EC 3.4.21.26) | Gluconobacter oxydans |
| gluox-q5fum7 | Gluconobacter oxydans (Gluconobacter suboxydans) prolyl-oligopeptidase | Gluconobacter oxydans |
| halbp-e4nkx5 | Halogeometricum borinquense, Serine protease, S9A family peptidase | Halogeometricum borinquense DSM 11551 |
| haldh-a0a1x9t5x9 | Haliotis discus hannai (Japanese abalone) Prolyl endopeptidase |
Haliotis discus hannai |
| human-PREP | Homo sapiens (Human) Prolyl endopeptidase PE, Post-proline cleaving enzyme PPCE, prolyl oligopeptidase POP hPOP |
Homo sapiens |
| idilo-q5qxf1 | Idiomarina loihiensis prolyl endopeptidase | Idiomarina loihiensis |
| idilo-q5qy75 | Idiomarina loihiensis prolyl endopeptidase | Idiomarina loihiensis |
| kinra-q410d8 | Kineococcus radiotolerans SRS30216 prolyl oligopeptidase (EC 3.4.21.26) | Kineococcus radiotolerans SRS30216 |
| leima-q4q080 | Leishmania major prolyl oligopeptidase (EC 3.4.21.26) | Leishmania major |
| meiru-a0a0s7auy3 | Meiothermus ruber H328 prolyl oligopeptidase | Meiothermus ruber H328 |
| meslo-MLL1209 | Rhizobium loti (Mesorhizobium loti) probable endopeptidase | Rhizobium loti |
| mouse-ppce | Mus musculus (Mouse) (PE) prolyl endopeptidase POP PREP | Mus musculus |
| mycpa-q73sx2 | Mycobacterium paratuberculosis hypothetical protein | Mycobacterium paratuberculosis |
| myctu-RV0457C | Mycobacterium tuberculosis and Mycobacterium bovis prolyl oligopeptidase family protein 74.5 kda RV0457C | Mycobacterium tuberculosis |
| mycvi-a4t2y2 | Mycobacterium gilvum (Mycobacterium flavescens), Mycobacterium sp., prolyl oligopeptidase, n-terminal beta-propeller | Mycobacterium gilvum PYR-GCK |
| mycvn-q267q6 | Mycobacterium vanbaalenii PYR-1 prolyl oligopeptidase precursor (EC 3.4.21.26) | Mycobacterium vanbaalenii PYR-1 |
| myxxa-PEP | Myxococcus xanthus prolyl endopeptidase precursor pep |
Myxococcus xanthus |
| neime-NMB1877 | Neisseria meningitidis, Neisseria gonorrhoeae, N. lactamica, N. sicca, N. polysaccharea, N. cinerea, N. mucosa, N. flavescens, N. subflava, prolyl oligopeptidase family protein | Neisseria meningitidis |
| nocfa-q5ynx0 | Nocardia farcinica putative peptidase | Nocardia farcinica |
| novad-q2g5b2 | Novosphingobium aromaticivorans (strain DSM 12444) prolyl oligopeptidase precursor (EC 3.4.21.26) | Novosphingobium aromaticivorans |
| novad-q2g5b3 | Novosphingobium aromaticivorans (strain DSM 12444) prolyl oligopeptidase precursor (EC 3.4.21.26) | Novosphingobium aromaticivorans |
| ompol-OphP | Omphalotus olearius (Jack o'lantern) macrocyclase OphP prolyl oligopeptidase |
Omphalotus olearius |
| orysa-Q658B2 | Oryza sativa subsp. indica subsp. japonica (Rice) putative prolyl endopeptidase | Oryza sativa |
| orysa-q7xsq2 | Oryza sativa subsp. indica subsp. japonica (Rice) osjnba0084k11.14 protein | Oryza sativa |
| pelld-q3b4s7 | Pelodictyon luteolum (strain DSM 273) (Chlorobium luteolum strain DS273 prolyl oligopeptidase precursor (EC 3.4.21.26) | Pelodictyon luteolum |
| pig-ppce | Pig prolyl endopeptidase |
Sus scrofa |
| prb01-Q9F7Q5 | Gamma-proteobacterium EBAC31A08 predicted prolyl endopeptidase | uncultured proteobacterium EBAC31A08 |
| proae-q3vvf8 | Prosthecochloris aestuarii DSM 271 prolyl oligopeptidase precursor (EC 3.4.21.26) | Prosthecochloris aestuarii DSM 271 |
| psea6-q15s45 | Pseudoalteromonas atlantica (strain T6c \/ ATCC BAA-1087) prolyl oligopeptidase precursor (EC 3.4.21.26) | Pseudoalteromonas atlantica T6c |
| pseht-q3ikv5 | Pseudoalteromonas haloplanktis (strain TAC 125) prolyl endopeptidase (EC 3.4.21.26) | Pseudoalteromonas haloplanktis |
| pyrab-PAB0762 | Pyrococcus abyssi prolyl endopeptidase | Pyrococcus abyssi |
| pyrfu-Q51714 | Pyrococcus furiosus prolyl endopeptidase |
Pyrococcus furiosus |
| pyrho-PH1262 | Pyrococcus horikoshii 617aa long hypothetical prolyl endopeptidase | Pyrococcus horikoshii |
| pyrko-q5jd37 | Pyrococcus kodakaraensis (Thermococcus kodakaraensis) prolyl endopeptidase | Pyrococcus kodakaraensis |
| ratno-RPOP | Rattus norvegicus (Rat) Prolyl endopeptidase rPop | Rattus norvegicus |
| rhiec-q2ka74 | Rhizobium etli (strain CFN 42 \/ ATCC 51251) putative peptidase protein | Rhizobium etli |
| rhil3-q1miz0 | Rhizobium leguminosarum bv. viciae (strain 3841) putative prolyl endopeptidase (EC 3.4.21.26) | Rhizobium leguminosarum bv. viciae |
| rhisn-y4na | Rhizobium sp. (strain NGR234) probable peptidase y4na (EC 3.4.21.-) | Rhizobium sp. |
| rhoba-q7uit3 | Rhodopirellula baltica prolyl endopeptidase (EC 3.4.21.26) | Rhodopirellula baltica |
| rhop5-q07r86 | Rhodopseudomonas palustris (strain BisA53) prolyl oligopeptidase (EC 3.4.21.26) | Rhodopseudomonas palustris BisA53 |
| rhopb-q218p9 | Rhodopseudomonas palustris (strain BisB18) peptidase s9, prolyl oligopeptidase active site region | Rhodopseudomonas palustris |
| ricpr-y174 | Rickettsia prowazekii probable peptidase rp174 (EC 3.4.21.-) | Rickettsia prowazekii |
| ricty-q68xj3 | Rickettsia typhi prolyl oligopeptidase family protein (EC 3.4.21.26) |
Rickettsia typhi |
| schja-q5c1s0 | Schistosoma japonicum (Blood fluke, platyhelminth) hypothetical protein | Schistosoma japonicum |
| shefr-q3nsv1 | Shewanella frigidimarina NCIMB 400 prolyl oligopeptidase precursor (EC 3.4.21.26) | Shewanella frigidimarina NCIMB 400 |
| sheon-SO2047 | Shewanella oneidensis (and Shewanella sp. MR-4, Shewanella putrefaciens CN-32 Shewanella sp. MR-7 Shewanella sp. ANA-3) prolyl oligopeptidase family protein | Shewanella oneidensis |
| sheon-SO2753 | Shewanella oneidensis, Shewanella baltica, Shewanella sp., Shewanella putrefaciens, prolyl endopeptidase | Shewanella oneidensis |
| solus-q43vk0 | Solibacter usitatus Ellin6076 prolyl oligopeptidase (EC 3.4.21.26) | Solibacter usitatus Ellin6076 |
| sphca-Q9ZNM8 | Sphingomonas capsulata (Flavobacterium capsulata)prolyl oligopeptidase precursor (EC 3.4.21.26) (PE) |
Sphingomonas capsulata |
| sulto-ST0002 | Sulfolobus tokodaii putative prolyl endopeptidase | Sulfolobus tokodaii |
| synja-q2jrs3 | Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime) prolyl oligopeptidase (EC 3.4.21.26) | Synechococcus sp. |
| synjb-q2jit4 | Synechococcus sp. (strain JA-2-3B'a(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime) prolyl oligopeptidase (EC 3.4.21.26) | Synechococcus sp. |
| tetng-q4rkk3 | Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis) hypothetical protein (fragment) | Tetraodon nigroviridis |
| tetng-q4s6t6 | Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis) hypothetical protein (fragment) | Tetraodon nigroviridis |
| thefy-q47ms4 | Thermobifida fusca (strain YX) prolyl oligopeptidase (EC 3.4.21.26) | Thermobifida fusca |
| thefy-q47nt0 | Thermobifida fusca (strain YX) prolyl oligopeptidase (EC 3.4.21.26) | Thermobifida fusca |
| trede-q73nf8 | Treponema denticola prolyl endopeptidase (EC 3.4.21.26) | Treponema denticola |
| trier-q3hef0 | Trichodesmium erythraeum IMS101 prolyl oligopeptidase (EC 3.4.21.26) | Trichodesmium erythraeum IMS101 |
| tryb2-q6ha27 | Trypanosoma brucei prolyl oligopeptidase (EC 3.4.21.26) | Trypanosoma brucei |
| trycr-TCPO | Trypanosoma cruzi Trypanosoma cruzi 80 kDa prolyl oligopeptidase (TCPO) mRNA, (EC 3.4.21.26) | Trypanosoma cruzi |
| ustma-q4p3m5 | Ustilago maydis (strain 521 \/ FGSC 9021) (Corn smut fungus) Prolyl endopeptidase | Ustilago maydis 521 |
| vibf1-q5e5s9 | Vibrio fischeri (strain ATCC 700601 \/ ES114) prolyl endopeptidase (EC 3.4.21.26) | Vibrio fischeri |
| vibpa-VPA0468 | Vibrio parahaemolyticus, Vibrionales bacterium, Vibrio alginolyticus, Vibrio sp., prolyl endopeptidase | Vibrio parahaemolyticus |
| vibpa-VPA1496 | Vibrio parahaemolyticus, Vibrio alginolyticus, Vibrio harveyi, Vibrio sp. prolyl endopeptidase | Vibrio parahaemolyticus |
| vibvu-VV20795 | Vibrio vulnificus and strain YJ016 serine protease of the peptidase family s9a | Vibrio vulnificus |
| xanax-XAC0628 | Xanthomonas axonopodis, Xanthomonas campestris, Xanthomonas oryzae, Xanthomonas fuscans, Xanthomonas vesicatoria, Xanthomonas perforans, Xanthomonas gardneri, prolyl oligopeptidase | Xanthomonas axonopodis |
| xenla-ppce | Xenopus laevis (African clawed frog) similar to prolyl endopeptidase (fragment) | Xenopus laevis |
| xentr-q6p4w3 | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) hypothetical protein mgc76255 | Xenopus tropicalis |
| zymmo-q5npe2 | Zymomonas mobilis prolyl oligopeptidase family protein | Zymomonas mobilis |
| Gene_locus_frgt | Name | Species |
|---|---|---|
| ricco-RC0215 | Rickettsia conorii and Rickettsia sibirica similarity to prolyl endopeptidase | Rickettsia conorii |
| ricfe-q4ukh6 | Rickettsia felis (Rickettsia azadi) prolyl endopeptidase (EC 3.4.21.26) | Rickettsia felis |
| spofr-Q8ISQ9 | Spodoptera frugiperda (Fall armyworm) prolyl endopeptidase (fragment) | Spodoptera frugiperda |
| Substrate | Chemical Nomenclature | Proteins |
|---|---|---|
| Abz-GLY-PHE-GLY-PRO-PHE-GLY | N-(2-Aminobenzoyl)glycyl-L-phenylalanylglycyl-L-prolyl-N-(2-oxoethyl)-L-phenylalaninamide | pig-ppce |
| Alpha-amanitin-proprotein | 9agar-h2e7q8 | |
| Glu-Phe-Ser-Pro | 1-[2-[[2-[(2-amino-4-carboxybutanoyl)amino]-3-phenylpropanoyl]amino]-3-hydroxypropanoyl]pyrrolidine-2-carboxylic acid | pig-ppce |
| Gly-Phe-Arg-Pro | 1-[2-[[2-[(2-aminoacetyl)amino]-3-phenylpropanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]pyrrolidine-2-carboxylic acid | pig-ppce |
| Gly-Phe-Glu-Pro | 1-[2-[[2-[(2-aminoacetyl)amino]-3-phenylpropanoyl]amino]-4-carboxybutanoyl]pyrrolidine-2-carboxylic acid | pig-ppce |
| Octadecaneuropeptide | (2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-4-amino-2-[[(2S)-2-[[(2S)-3-carboxy-2-[[2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2,5-diamino-5-oxopentanoyl]amino]propanoyl]amino]-3-hydroxybutanoyl]amino]-3-methylbutanoyl]amino]acetyl]amino]propanoyl]amino]-3-methylbutanoyl]amino]-4-oxobutanoyl]amino]-3-hydroxybutanoyl]amino]-3-carboxypropanoyl]amino]-5-carbamimidamidopentanoyl]pyrrolidine-2-carbonyl]amino]acetyl]amino]-4-methylpentanoyl]amino]-4-methylpentanoyl]amino]-3-carboxypropanoyl]amino]-4-methylpentanoyl]amino]hexanoic acid | human-PREP |
| Omphalotin-A | (3S,6S,9S,12S,15S,21S,24S,30S,33S)-9,21,30-tris[(2S)-butan-2-yl]-15-(1H-indol-3-ylmethyl)-1,4,7,13,19,22,28,31,34-nonamethyl-3,6,12,24,33-penta(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31,34-dodecazacyclohexatriacontane-2,5,8,11,14,17,20,23,26,29,32,35-dodecone | ompol-OphP |
| OphMA-core-peptide-15mer | ompol-OphP | |
| OphMA-core-peptide-18mer | ompol-OphP | |
| Thymosin-beta4 | (4S)-4-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S,3S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S,3S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-2-acetamido-3-hydroxypropanoyl]amino]-3-carboxypropanoyl]amino]-6-aminohexanoyl]pyrrolidine-2-carbonyl]amino]-3-carboxypropanoyl]amino]-4-methylsulfanylbutanoyl]amino]propanoyl]amino]-4-carboxybutanoyl]amino]-3-methylpentanoyl]amino]-4-carboxybutanoyl]amino]-6-aminohexanoyl]amino]-3-phenylpropanoyl]amino]-3-carboxypropanoyl]amino]-6-aminohexanoyl]amino]-3-hydroxypropanoyl]amino]-6-aminohexanoyl]amino]-4-methylpentanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanoyl]amino]-3-hydroxybutanoyl]amino]-4-carboxybutanoyl]amino]-3-hydroxybutanoyl]amino]-5-amino-5-oxopentanoyl]amino]-4-carboxybutanoyl]amino]-6-aminohexanoyl]amino]-4-amino-4-oxobutanoyl]pyrrolidine-2-carbonyl]amino]-4-methylpentanoyl]pyrrolidine-2-carbonyl]amino]-3-hydroxypropanoyl]amino]-6-aminohexanoyl]amino]-4-carboxybutanoyl]amino]-3-hydroxybutanoyl]amino]-3-methylpentanoyl]amino]-4-carboxybutanoyl]amino]-5-amino-5-oxopentanoyl]amino]-4-carboxybutanoyl]amino]-6-aminohexanoyl]amino]-5-amino-5-oxopentanoyl]amino]propanoyl]amino]acetyl]amino]-5-[[(1S)-1-carboxy-2-hydroxyethyl]amino]-5-oxopentanoic acid | human-PREP |
| Z-Gly-Pro-AMC | benzyl N-[2-[(2S)-2-[(4-methyl-2-oxochromen-7-yl)carbamoyl]pyrrolidin-1-yl]-2-oxoethyl]carbamate | human-FAP |
| Z-Gly-Pro-pNA | benzyl N-[2-[(2S)-2-[(4-nitrophenyl)carbamoyl]pyrrolidin-1-yl]-2-oxoethyl]carbamate | 9gamm-MaPOP |
| Inhibitor | Chemical Nomenclature | Proteins |
|---|---|---|
| 2-(N-Morpholino)ethanesulfonic-acid | 2-morpholin-4-ylethanesulfonic acid | pseae-PA3859 9gamm-MaPOP |
| ARI-3531 | [(2S)-1-[(2R)-3-methyl-2-(pyridine-4-carbonylamino)butanoyl]pyrrolidin-2-yl]boronic acid | human-PREP |
| ArM-dirhodium-cofactor | pyrfu-Q51714 | |
| CHEMBL1086968 | [(2S,3aS,7aS)-2-(1,3-thiazolidine-3-carbonyl)-2,3,3a,4,5,6,7,7a-octahydroindol-1-yl]-[(1R,2R)-2-phenylcyclopropyl]methanone | human-PREP |
| CHEMBL3817958 | (2S)-1-[(3aS,4R,7aR)-2-benzyl-3-oxo-3a,4,5,7a-tetrahydro-1H-isoindole-4-carbonyl]pyrrolidine-2-carbonitrile | human-PREP |
| CHEMBL387444 | [(2R)-1-[2-(cyclohexanecarbonylamino)acetyl]pyrrolidin-2-yl]boronic acid | human-PREP human-FAP |
| CHEMBL4559324 | N-[3-methoxy-4-[(2R)-2-[(1S,2S,6R,8S)-2,9,9-trimethyl-3,5-dioxa-4-boratricyclo[6.1.1.02,6]decan-4-yl]pyrrolidine-1-carbonyl]phenyl]acetamide | human-PREP |
| CHEMBL4576969 | (2-methylsulfanylphenyl)-[(2R)-2-[(1S,2S,6R,8S)-2,9,9-trimethyl-3,5-dioxa-4-boratricyclo[6.1.1.02,6]decan-4-yl]pyrrolidin-1-yl]methanone | human-PREP |
| DB07148 | (6S)-1-chloro-3-[(4-fluorophenyl)methoxy]-6-(pyrrolidine-1-carbonyl)-6H-pyrrolo[1,2-a]pyrazin-4-one | human-PREP |
| Fmoc-prolyl-pyrrolidine-2-nitrile | 9H-fluoren-9-ylmethyl (2S)-2-(2-cyanopyrrolidine-1-carbonyl)pyrrolidine-1-carboxylate | human-PREP |
| Follower-Peptide-Presegetalin-A1 | GVPVWAFQAKDVENASAPV | 9cary-r4p353 |
| JTP-4819 | (2S)-N-benzyl-2-[(2S)-2-(2-hydroxyacetyl)pyrrolidine-1-carbonyl]pyrrolidine-1-carboxamide | human-PREP |
| N-acyl-prolylpyrrolidine-inhibitor-1 | 1-[(2S,4S)-4-azido-2-[(2S)-2-methanimidoylpyrrolidine-1-carbonyl]pyrrolidin-1-yl]-4-phenylbutan-1-one | pig-ppce |
| N-acyl-prolylpyrrolidine-inhibitor-2 | tert-butyl N-[[1-[(3S,5S)-5-[(2S)-2-[(R)-amino(hydroxy)methyl]pyrrolidine-1-carbonyl]-1-(4-phenylbutanoyl)pyrrolidin-3-yl]triazol-4-yl]methyl]carbamate | pig-ppce |
| N-acyl-prolylpyrrolidine-inhibitor-3 | 1-[(2S,4S)-4-[4-(4-fluorophenyl)triazol-1-yl]-2-(pyrrolidine-1-carbonyl)pyrrolidin-1-yl]-4-phenylbutan-1-one | pig-ppce |
| NBD-HE-HP | N-[2-[hexyl-(4-nitrophenoxy)phosphoryl]oxyethyl]-6-[(4-nitro-2,1,3-benzoxadiazol-7-yl)amino]hexanamide | mouse-hslip mouse-Ces1d mouse-MGLL mouse-ES10 mouse-Abhd11 drome-CG2059 mouse-lypla2 drome-CG18815 mouse-lypla1 mouse-Ces1c mouse-Ces1f mouse-PPME1 mouse-apeh mouse-abhd5 drome-CG1882 mouse-lypl1 burce-lipaa rhidl-lipas drome-EST23aes07 drome-este6 drome-CG5355 drome-aes05 drome-aes02 drome-CG8425 |
| Polyozellin | (12-acetyloxy-6,7,16,17-tetrahydroxy-3,20-dioxapentacyclo[11.7.0.02,10.04,9.014,19]icosa-1(13),2(10),4,6,8,11,14,16,18-nonaen-11-yl) acetate | human-PREP |
| Presegetalin-A1 | MSPILAHDVVKPQGVPVWAFQAKDVENASAPV | 9cary-r4p353 |
| Presegetalin-B1 | MSPILAHDVVKPQGVAWAFQAKDVENASAPV | 9cary-r4p353 |
| Presegetalin-F1 | MATSFQFDGLKPSFSASYSSKPIQTQVSNGMDNASAPV | 9cary-r4p353 |
| R-Pro-(decarboxy-Pro)-X97 | 3-[4-oxo-4-[(2S)-2-(pyrrolidine-1-carbonyl)pyrrolidin-1-yl]butyl]-5,5-diphenylimidazolidine-2,4-dione | pig-ppce |
| R-Pro-(decarboxy-Pro)-X98 | 1-[3-oxo-3-[(2S)-2-(pyrrolidine-1-carbonyl)pyrrolidin-1-yl]propyl]-3-phenylquinoxalin-2-one | pig-ppce |
| R-Pro-(decarboxy-Pro)-X99 | 2-[3-[(2S)-4,4-difluoro-2-(pyrrolidine-1-carbonyl)pyrrolidin-1-yl]-3-oxopropyl]isoindole-1,3-dione | pig-ppce |
| SUAM-14746 | 1-[(2~{S})-4-hydroxy-2-(1,3-thiazolidine-3-carbonyl)pyrrolidin-1-yl]-4-[2-[(~{E})-2-phenylethenyl]phenoxy]butan-1-one | haldh-a0a1x9t5x9 human-PREP |
| Sin-Gly-Pro | (2S)-1-[2-(3-carboxypropanoylamino)acetyl]pyrrolidine-2-carboxylic acid | pig-ppce |
| Verbascoside | [(2R,3R,4R,5R,6R)-6-[2-(3,4-dihydroxyphenyl)ethoxy]-5-hydroxy-2-(hydroxymethyl)-4-[(2S,3R,4R,5R,6S)-3,4,5-trihydroxy-6-methyloxan-2-yl]oxyoxan-3-yl] (E)-3-(3,4-dihydroxyphenyl)prop-2-enoate | human-PREP |
| Z-321 | 2-(2,3-dihydro-1H-inden-2-yl)-1-[(4R)-4-(pyrrolidine-1-carbonyl)-1,3-thiazolidin-3-yl]ethanone | human-PREP |
| Z-Ala_prolinal | (2S)-1-[(2S)-2-(phenylmethoxycarbonylamino)propanoyl]pyrrolidine-2-carboxylic acid | myxxa-PEP |
| Z-Gly-Pro | (2S)-1-[2-(phenylmethoxycarbonylamino)acetyl]pyrrolidine-2-carboxylic acid | pig-ppce |
| Z-Pro-Prolinal | benzyl (2S)-2-[(2S)-2-formylpyrrolidine-1-carbonyl]pyrrolidine-1-carboxylate | pig-ppce aerpu-PEP 9gamm-MaPOP |
| Z-Pro-Prolinal-IC1 | 1-[(2R,5S)-2-tert-butyl-5-[(2S)-2-[(1R)-1,2-dihydroxyethyl]pyrrolidine-1-carbonyl]pyrrolidin-1-yl]-4-phenylbutan-1-one | pig-ppce |
| Z-Pro-Prolinal-IC2 | (5R)-N-benzyl-5-[(2S)-2-[(1R)-1,2-dihydroxyethyl]pyrrolidine-1-carbonyl]cyclopentene-1-carboxamide | pig-ppce |
| Z-Pro-Prolinal-IC3 | (2S)-1-[(2S)-1-(4-phenylbutanoyl)pyrrolidine-2-carbonyl]pyrrolidine-2-carbonitrile | pig-ppce |
| Z-Pro-Prolinal-IC4 | (2S)-N-benzyl-2-[(2S)-2-[(1R)-1,2-dihydroxyethyl]pyrrolidine-1-carbonyl]pyrrolidine-1-carboxamide | pig-ppce |
| Z-Pro-Prolinal-derived | benzyl (2S)-2-[(2S)-2-(hydroxymethyl)piperidine-1-carbonyl]pyrrolidine-1-carboxylate | pig-ppce |
| spiro-b-lactam-pyrroloquinoline-6b | pig-ppce |
References (6)
| Title : The Dipeptidyl Peptidase Family, Prolyl Oligopeptidase, and Prolyl Carboxypeptidase in the Immune System and Inflammatory Disease, Including Atherosclerosis - Waumans_2015_Front.Immunol_6_387 |
| Author(s) : Waumans Y , Baerts L , Kehoe K , Lambeir AM , De Meester I |
| Ref : Front Immunol , 6 :387 , 2015 |
| Abstract : |
| PubMedSearch : Waumans_2015_Front.Immunol_6_387 |
| PubMedID: 26300881 |
| Title : Prolyl oligopeptidase binds to GAP-43 and functions without its peptidase activity - Di Daniel_2009_Mol.Cell.Neurosci_41_373 |
| Author(s) : Di Daniel E , Glover CP , Grot E , Chan MK , Sanderson TH , White JH , Ellis CL , Gallagher KT , Uney J , Thomas J , Maycox PR , Mudge AW |
| Ref : Molecular & Cellular Neurosciences , 41 :373 , 2009 |
| Abstract : |
| PubMedSearch : Di Daniel_2009_Mol.Cell.Neurosci_41_373 |
| PubMedID: 19332125 |
| Gene_locus related to this paper: human-PREP , mouse-ppce |
| Title : The prolyl oligopeptidase family - Polgar_2002_Cell.Mol.Life.Sci_59_349 |
| Author(s) : Polgar L |
| Ref : Cell Mol Life Sciences , 59 :349 , 2002 |
| Abstract : |
| PubMedSearch : Polgar_2002_Cell.Mol.Life.Sci_59_349 |
| PubMedID: 11915948 |
| Title : Catalysis of serine oligopeptidases is controlled by a gating filter mechanism - Fulop_2000_EMBO.Rep_1_277 |
| Author(s) : Fulop V , Szeltner Z , Polgar L |
| Ref : EMBO Rep , 1 :277 , 2000 |
| Abstract : |
| PubMedSearch : Fulop_2000_EMBO.Rep_1_277 |
| PubMedID: 11256612 |
| Gene_locus related to this paper: pig-ppce |
| Title : Prolyl oligopeptidase: an unusual beta-propeller domain regulates proteolysis - Fulop_1998_Cell_94_161 |
| Author(s) : Fulop V , Bocskei Z , Polgar L |
| Ref : Cell , 94 :161 , 1998 |
| Abstract : |
| PubMedSearch : Fulop_1998_Cell_94_161 |
| PubMedID: 9695945 |
| Gene_locus related to this paper: pig-ppce |
| Title : Structural relationship between lipases and peptidases of the prolyl oligopeptidase family - Polgar_1992_FEBS.Lett_311_281 |
| Author(s) : Polgar L |
| Ref : FEBS Letters , 311 :281 , 1992 |
| Abstract : |
| PubMedSearch : Polgar_1992_FEBS.Lett_311_281 |
| PubMedID: 1397329 |