1. Home
  2. Family
  3. S9N_PPCE_Peptidase_S9

S9N_PPCE_Peptidase_S9

Relationship

Family: S9N_PPCE_Peptidase_S9

Block: X

Parent Family: Peptidase_S9

Comment

prolyl oligopeptidase (EC 3.4.21.26) (also called post-proline cleaving enzyme PPCE, Prolyl endopeptidase PE, prolyl oligopeptidase POP). Prolyl oligopeptidases are either located in the cytosol or they are membrane bound, where they cleave peptide bonds with prolyl P1 specificities (but cleavage of alanyl bonds has been detected). The proline must adopt a trans con- figuration within the chain. Peptides of up to 30 residues are cleaved. N-terminal domain is a 7-bladed beta-propeller

Database

Interpro : IPR004106 Peptidase S9A\/B\/C, oligopeptidase, N-terminal beta-propeller , IPR001375 Peptidase_S9

PIRSF : No PIRSF

Pdoc : No Pdoc

Pfam : PF00326 Peptidase_S9 , PF02897 Peptidase_S9_N

Prints : No Print

EC Number : No EC Number

Sequences

Peptide in Fasta
Nucleotide in Fasta
Alignment with Multalin Text only
Seed alignment with MAFFT No colour / coloured with Mview
Alignment with MAFFT No colour / coloured with Mview
Dendrogram The dnd file

Structure Name Proteins
7ZAZ Omphalotus olearius macrocyclase OphP with ZPP ompol-OphP
7ZB0 Omphalotus olearius macrocyclase OphP with 15mer ompol-OphP
7ZB1 Omphalotus olearius macrocyclase OphP S580A with 18mer ompol-OphP
7ZB2 Omphalotus olearius macrocyclase OphP S580A apo ompol-OphP
7Y1X Crystal structure of prolyl oligopeptidase from Microbulbifer arenaceous complex with PEG400 and MES 9gamm-MaPOP
7VGB Crystal structure of apo prolyl oligopeptidase from Microbulbifer arenaceous 9gamm-MaPOP
7VGC Crystal structure of prolyl oligopeptidase from Microbulbifer arenaceous complex with a transition state analog inhibitor ZPR 9gamm-MaPOP
6JYM Crystal structure of Prolyl Endopeptidase from Haliotis discus hannai haldh-a0a1x9t5x9
6JCI Crystal structure of Prolyl Endopeptidase from Haliotis discus hannai with SUAM-14746 haldh-a0a1x9t5x9
6CAN Prolyl oligopeptidase mutant S477C from Pyrococcus furiosus pyrfu-Q51714
5N4B Prolyl oligopeptidase B from Galerina marginata bound to 25mer macrocyclization substrate - S577A mutant 9agar-h2e7q8
5N4C Prolyl oligopeptidase B from Galerina marginata bound to 35mer hydrolysis and macrocyclization substrate - S577A mutant 9agar-h2e7q8
5N4D Prolyl oligopeptidase B from Galerina marginata bound to 25mer macrocyclization substrate - D661A mutant 9agar-h2e7q8
5N4E Prolyl oligopeptidase B from Galerina marginata bound to 35mer hydrolysis and macrocyclization substrate - H698A mutant 9agar-h2e7q8
5N4F Prolyl oligopeptidase B from Galerina marginata - apo protein 9agar-h2e7q8
5T88 Prolyl oligopeptidase from Pyrococcus furiosus pyrfu-Q51714
5O3U Structural characterization of the fast and promiscuous macrocyclase from plant - PCY1-S562A bound to Presegetalin F1 9cary-r4p353
5O3V Structural characterization of the fast and promiscuous macrocyclase from plant Gypsophila vaccaria (Cow soapwort) - PCY1-S562A bound to Presegetalin B1 9cary-r4p353
5O3X Structural characterization of the fast and promiscuous macrocyclase from plant Gypsophila vaccaria (Cow soapwort) - apo PCY1 9cary-r4p353
5O3W Structural characterization of the fast and promiscuous macrocyclase from plant Gypsophila vaccaria (Cow soapwort) - PCY1-S562A bound to Presegetalin A1 9cary-r4p353
5UW3 Gypsophila vaccaria (Cow soapwort) macrocyclase PCY1 involved in the biosynthesis of RiPP cyclic peptide in complex with follower peptide 9cary-r4p353
5UW6 Gypsophila vaccaria (Cow soapwort) macrocyclase PCY1 involved in the biosynthesis of RiPP cyclic peptide in complex with follower peptide and covalent inhibitor ZPP 9cary-r4p353
5UW5 Gypsophila vaccaria (Cow soapwort) macrocyclase PCY1 involved in the biosynthesis of RiPP cyclic peptide PCY1 H695A Variant in Complex with Follower Peptide 9cary-r4p353
5UW7 PCY1 Y481F Variant in Complex with Follower Peptidee 9cary-r4p353
5UZW PCY1 G696Insertion Variant in Complex with Follower Peptide and the Covalent Inhibitor ZPP Z-Pro-Prolinal 9cary-r4p353
4HVT Structure of a Post-proline cleaving enzyme from Rickettsia typhi ricty-q68xj3
4BCB Prolyl Oligopeptidase from porcine brain with a covalently bound P2- substituted N-acyl-prolylpyrrolidine inhibitor 1 pig-ppce
4BCC Prolyl Oligopeptidase from porcine brain with a covalently bound P2-substituted N-acyl-prolylpyrrolidine inhibitor 2 pig-ppce
4BCD Prolyl Oligopeptidase from porcine brain with a non-covalently bound P2- substituted N-acyl-prolylpyrrolidine inhibitor 3 pig-ppce
4AX4 Prolyl Oligopeptidase from porcine brain, H680A mutant pig-ppce
4AMY Prolyl Oligopeptidase from porcine brain with a covalently bound inhibitor IC-1 pig-ppce
4AMZ Prolyl Oligopeptidase from porcine brain with a covalently bound inhibitor IC-2 pig-ppce
4AN0 Prolyl Oligopeptidase from porcine brain with a covalently bound inhibitor IC-3 pig-ppce
4AN1 Prolyl Oligopeptidase from porcine brain with a covalently bound inhibitor IC-4 pig-ppce
2XDW Inhibition of Prolyl Oligopeptidase with a Synthetic Unnatural Dipeptide pig-ppce
3MUN Aeromonas punctata Prolyl Endopeptidase APPEP_PEPCLOSE closed state aerpu-PEP
3MUO Aeromonas punctata Prolyl Endopeptidase APPEP_PEPCLOSE+PP closed state aerpu-PEP
3IUJ Aeromonas punctata Prolyl Endopeptidase apPEP_WT2 opened state aerpu-PEP
3IUL Aeromonas punctata Prolyl Endopeptidase apPEP_WT1 opened state aerpu-PEP
3IUM Aeromonas punctata Prolyl Endopeptidase apPEP_WTX opened state aerpu-PEP
3IUN Aeromonas punctata Prolyl Endopeptidase apPEP_D622N opened state aerpu-PEP
3IUQ Aeromonas punctata Prolyl Endopeptidase apPEP_D622N+PP closed state aerpu-PEP
3IUR Aeromonas punctata Prolyl Endopeptidase apPEP_D266Nx+H2H3 opened state aerpu-PEP
3IVM Aeromonas punctata Prolyl Endopeptidase apPEP_WT+PP closed state aerpu-PEP
3EQ7 Prolyl oligopeptidase complexed with R-Pro-(decarboxy-Pro)-Type inhibitors 1 pig-ppce
3EQ8 Prolyl oligopeptidase complexed with R-Pro-(decarboxy-Pro)-Type inhibitors 2 pig-ppce
3EQ9 Prolyl oligopeptidase complexed with R-Pro-(decarboxy-Pro)-Type inhibitors 3 pig-ppce
3DDU Prolyl Oligopeptidase with GSK552 human-PREP
1E5T Prolyl oligopeptidase from C255T\/Q397C\/K684M pig mutant pig-ppce
1E8M Prolyl oligopeptidase from pig brain mutant covalently bound Z pro prolinal pig-ppce
1E8N Prolyl oligopeptidase from pig brain mutant covalently bound octapeptide pig-ppce
1H2W Prolyl Oligopeptidase From Porcine Brain pig-ppce
1H2X Prolyl Oligopeptidase From Porcine Brain, Y473F Mutant pig-ppce
1H2Y Prolyl Oligopeptidase From Porcine Brain, Y473F Mutant With Covalently Bound Inhibitor Z-Pro-Prolinal pig-ppce
1H2Z Prolyl Oligopeptidase From Porcine Brain, S554A Mutant With Bound Peptide Ligand Suc-Gly-Pro pig-ppce
1O6F Prolyl Oligopeptidase From Porcine Brain, D641A Mutant With Bound Peptide Ligand Suc-Gly-Pro pig-ppce
1O6G Prolyl Oligopeptidase From Porcine Brain, D641N Mutant With Bound Peptide Ligand Suc-Gly-Pro pig-ppce
1QFM Prolyl oligopeptidase from pig pig-ppce
1QFS Prolyl oligopeptidase with covalently bound inhibitor Z-pro-prolinal from pig pig-ppce
1UOO Prolyl Oligopeptidase From Porcine Brain, S554A Mutant With Bound Peptide Ligand Gly-Phe-Arg-Pro pig-ppce
1UOP Prolyl Oligopeptidase From Porcine Brain, S554A Mutant With Bound Peptide Ligand Gly-Phe-Glu-Pro pig-ppce
1UOQ Prolyl Oligopeptidase From Porcine Brain, S554A Mutant With Bound Peptide Ligand Glu-Phe-Ser-Pro pig-ppce
1VZ2 Prolyl oligopeptidase from porcine brain Y73C\/V427C\/C255T mutant pig-ppce
1VZ3 Prolyl oligopeptidase from porcine brain T597C mutant pig-ppce
1YR2 Prolyl endopeptidase from Sphingomonas capsulata open configuration sphca-Q9ZNM8
2BKL Prolyl endopeptidase from Myxococcus xanthus inhibited by Z-Ala_prolinal closed form myxxa-PEP

Gene_locus Name Species
amaex-AePOPB Amanita exitialis (Guangzhou destroying angel) Prolyl endopeptidase Amanita exitialis
ompol-OphP Omphalotus olearius (Jack o'lantern) macrocyclase OphP prolyl oligopeptidase Omphalotus olearius
9hemi-e1u339 Eurygaster integriceps Prolyl endopeptidase salivary glutenase spPEP Eurygaster integriceps
9gamm-MaPOP Microbulbifer arenaceous prolyl oligopeptidase MaPOP Microbulbifer arenaceous
9cary-r4p353 Gypsophila vaccaria Prolyl endopeptidase Pcy1 Gypsophila vaccaria
meiru-a0a0s7auy3 Meiothermus ruber H328 prolyl oligopeptidase Meiothermus ruber H328
haldh-a0a1x9t5x9 Haliotis discus hannai (Japanese abalone) Prolyl endopeptidase Haliotis discus hannai
9agar-h2e7q8 Galerina marginata Prolyl oligopeptidase POPB Galerina marginata
frasn-A8L5U7 Frankia sp. EAN1pec prolyl oligopeptidase (EC 3.4.21.26) Frankia sp. EAN1pec
9bact-q26h93 Flavobacteria bacterium BBFL7 prolyl endopeptidase serine protease (EC 3.4.21.26) Flavobacteria bacterium BBFL7
9chlb-q4alz1 Chlorobium phaeobacteroides BS1 prolyl oligopeptidase precursor (EC 3.4.21.26) Chlorobium phaeobacteroides BS1
9chlb-q43eh9 Chlorobium phaeobacteroides DSM 266 prolyl oligopeptidase precursor (EC 3.4.21.26) Chlorobium phaeobacteroides DSM 266
9eury-b7r0s6 Thermococcus sp. AM4 Prolyl endopeptidase Thermococcus sp. AM4
9flao-q1vxy2 Psychroflexus torquis (strain ATCC 700755 \/ ACAM 623) prolyl endopeptidase Psychroflexus torquis ATCC 700755
9flao-q1vz51 Psychroflexus torquis (strain ATCC 700755 \/ ACAM 623) prolyl oligopeptidase family protein Psychroflexus torquis ATCC 700755
9gamm-q2wwt8 Shewanella sp. W3-18-1 prolyl oligopeptidase precursor (EC 3.4.21.26) Shewanella sp. W3-18-1
9gamm-q2x3h7 Shewanella sp. W3-18-1 and Shewanella baltica OS155 prolyl oligopeptidase precursor (EC 3.4.21.26) Shewanella baltica OS155
9gamm-q3nyp6 Shewanella denitrificans OS217 prolyl oligopeptidase precursor (EC 3.4.21.26) Shewanella denitrificans OS217
9gamm-q3qdu6 Shewanella amazonensis SB2B prolyl oligopeptidase precursor (EC 3.4.21.26) Shewanella amazonensis SB2B
9gamm-q3qef8 Shewanella amazonensis SB2B prolyl oligopeptidase precursor (EC 3.4.21.26) Shewanella amazonensis SB2B
9gamm-q6ivm6 uncultured gamma proteobacterium eBACHOT4E07 predicted prolyl endopeptidase uncultured gamma proteobacterium eBACHOT4E07
9gamm-q6q963 uncultured marine gamma proteobacterium EBAC20E09 predicted prolyl endopeptidase (fragment) uncultured marine gamma proteobacterium EBAC20E09
9myco-q1tu32 Mycobacterium sp. (strains JLS\; KMS MCS) prolyl oligopeptidase (EC 3.4.21.26) Mycobacterium sp. JLS
9sphn-q1n9q7 Sphingomonas sp. SKA58 prolyl oligopeptidase family protein Sphingomonas sp. SKA58
9sphn-q1nec1 Sphingomonas sp. SKA58 prolyl oligopeptidase Sphingomonas sp. SKA58
9sphn-q2n8z0 Erythrobacter litoralis HTCC2594 prolyl oligopeptidase family protein Erythrobacter litoralis HTCC2594
9sphn-q3v961 Sphingopyxis alaskensis RB2256 prolyl oligopeptidase precursor (EC 3.4.21.26) Sphingopyxis alaskensis RB2256
acib4-b5ifw4 Aciduliprofundum boonei (strain DSM 19572 \/ T469) Prolyl oligopeptidase Aciduliprofundum boonei
acice-q2dz67 Acidothermus cellulolyticus 11B prolyl oligopeptidase (EC 3.4.21.26) Acidothermus cellulolyticus 11B
aerhy-ppce Aeromonas hydrophila prolyl endopeptidase Aeromonas hydrophila
aerpu-PEP Aeromonas punctata subsp. punctata prolyl endopeptidase (EC 3.4.21.26) Aeromonas punctata
ailme-d2h5r9 Ailuropoda melanoleuca (Giant panda) Putative uncharacterized protein Ailuropoda melanoleuca
anasp-ALL2533 Anabaena sp. (strain PCC 7120) Anabaena variabilis (strain ATCC 29413 \/ PCC 7937) prolyl endopeptidase Anabaena variabilis
anoga-q7pvv8 Anopheles gambiae str. PEST ensangp00000016749 (fragment) Anopheles gambiae
arath-AT1G76140 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) AT1G76140 t23e18.8 Arabidopsis thaliana
arath-F14O10.2 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress), AT1G20380 f14o10.2 protein Arabidopsis thaliana
arts2-a0jsq4 Arthrobacter sp. (strain FB24) prolyl oligopeptidase,active site region n-terminal beta-propeller Arthrobacter sp. FB24
bdeba-q6mhs4 Bdellovibrio bacteriovorus prolyl oligopeptidase family protein precursor Bdellovibrio bacteriovorus
bora1-q2kti1 Bordetella avium (strain 197N) putative prolyl endopeptidase Bordetella avium
bovin-ppce Bos taurus (Bovine) (PE) Bos taurus
braja-BLL1016 Bradyrhizobium japonicum bll1016 protein Bradyrhizobium japonicum
brasb-a5e9x2 Bradyrhizobium sp. probable peptidase Bradyrhizobium sp. BTAi1
burca-q1bhv9 Burkholderia cenocepacia prolyl oligopeptidase,active site and n-terminal beta-propeller Burkholderia cenocepacia
burcm-q0bdn4 Burkholderia ambifaria (Burkholderia cepacia) prolyl oligopeptidase, n-terminal beta-propeller Burkholderia ambifaria AMMD
burma-q62cg5 Burkholderia mallei (Pseudomonas mallei) Burkholderia pseudomallei (Pseudomonas pseudomallei), Burkholderia thailandensis, prolyl oligopeptidase family protein Burkholderia mallei
burvi-q4bjc3 Burkholderia vietnamiensis G4 prolyl oligopeptidase, n-terminal beta-propeller Burkholderia vietnamiensis G4
canfa-f1phx2 Canis lupus familiaris (Dog) (Canis familiaris) Uncharacterized protein Canis lupus familiaris
caucr-CC3687 Caulobacter crescentus prolyl oligopeptidase family protein Caulobacter crescentus
caucr-CC3688 Caulobacter crescentus prolyl oligopeptidase family protein Caulobacter crescentus
chick-q5zmi7 Gallus gallus (Chicken) hypothetical protein Gallus gallus
chll2-b3edc5 Chlorobium limicola (strain DSM 245 \/ NBRC 103803) prolyl oligopeptidase precursor (EC 3.4.21.26) Chlorobium limicola DSM 245
chlte-CT1301 Chlorobium tepidum prolyl oligopeptidase family protein Chlorobium tepidum
chlvi-q3ggi7 Prosthecochloris vibrioformis DSM 265 prolyl oligopeptidase precursor (EC 3.4.21.26) Prosthecochloris vibrioformis DSM 265
chrvo-q7nq34 Chromobacterium violaceum prolyl endopeptidase (EC 3.4.21.26) Chromobacterium violaceum
chrvo-q7nsc4 Chromobacterium violaceum prolyl oligopeptidase family protein Chromobacterium violaceum
colp3-q48aq9 Colwellia psychrerythraea (strain 34H \/ ATCC BAA-681) (Vibrio psychroerythus) prolyl endopeptidase (EC 3.4.21.26) Colwellia psychrerythraea
cordi-q6njn4 Corynebacterium diphtheriae putative prolyl oligopeptidase family protein Corynebacterium diphtheriae
coref-CE0354 Corynebacterium efficiens putative peptidase Corynebacterium efficiens
corgl-CGL0340 Corynebacterium glutamicum (Brevibacterium flavum) serine proteases of the peptidase family s9a (EC 3.4.21.26) Corynebacterium glutamicum
crowt-q4c6t5 Crocosphaera watsonii prolyl oligopeptidase (EC 3.4.21.26) Crocosphaera watsonii
cryne-q5kat4 Cryptococcus neoformans (Filobasidiella neoformans) (and var. neoformans B-3501A) prolyl endopeptidase, putative (EC 3.4.21.26) Cryptococcus neoformans
cryne-q5kav3 Cryptococcus neoformans (Filobasidiella neoformans) (and var. neoformans B-3501A) hypothetical protein Cryptococcus neoformans
cytjo-q1xjz5 Flavobacterium johnsoniae UW101 prolyl oligopeptidase precursor (EC 3.4.21.26) Flavobacterium johnsoniae UW101
cytjo-q1xv98 Flavobacterium johnsoniae UW101 prolyl oligopeptidase precursor (EC 3.4.21.26) Flavobacterium johnsoniae UW101
danre-q503e2 Danio rerio (Zebrafish) (Brachydanio rerio) hypothetical protein zgc:110670 Danio rerio
deira-DR2503 Deinococcus radiodurans prolyl endopeptidase Deinococcus radiodurans
dicdi-DPOA Dictyostelium discoideum (Slime mold) prolyl oligopeptidase (EC 3.4.21.26) Dictyostelium discoideum
drome-CG2528 Drosophila melanogaster (Fruit fly) cg2528 protein Drosophila melanogaster
drome-CG5355 Drosophila melanogaster (Fruit fly) cg5355 Prolyl endopeptidase Drosophila melanogaster
elimr-ppcf Elizabethkingia miricola (Chryseobacterium miricola) endopeptidase) (pse) (post-proline cleaving enzyme) (pe) Elizabethkingia miricola
flame-ppce Flavobacterium meningosepticum prolyl endopeptidase Flavobacterium meningosepticum
glovi-q7nga2 Gloeobacter violaceus prolyl endopeptidase Gloeobacter violaceus
glovi-q7nmt4 Gloeobacter violaceus prolyl endopeptidase Gloeobacter violaceus
glovi-q7nmz0 Gloeobacter violaceus prolyl endopeptidase Gloeobacter violaceus
gluox-q5ft19 Gluconobacter oxydans (Gluconobacter suboxydans) prolyl oligopeptidase family protein (EC 3.4.21.26) Gluconobacter oxydans
gluox-q5fum7 Gluconobacter oxydans (Gluconobacter suboxydans) prolyl-oligopeptidase Gluconobacter oxydans
halbp-e4nkx5 Halogeometricum borinquense, Serine protease, S9A family peptidase Halogeometricum borinquense DSM 11551
human-PREP Homo sapiens (Human) Prolyl endopeptidase PE, Post-proline cleaving enzyme PPCE, prolyl oligopeptidase POP Homo sapiens
idilo-q5qxf1 Idiomarina loihiensis prolyl endopeptidase Idiomarina loihiensis
idilo-q5qy75 Idiomarina loihiensis prolyl endopeptidase Idiomarina loihiensis
kinra-q410d8 Kineococcus radiotolerans SRS30216 prolyl oligopeptidase (EC 3.4.21.26) Kineococcus radiotolerans SRS30216
leima-q4q080 Leishmania major prolyl oligopeptidase (EC 3.4.21.26) Leishmania major
meslo-MLL1209 Rhizobium loti (Mesorhizobium loti) probable endopeptidase Rhizobium loti
mouse-ppce Mus musculus (Mouse) (PE) prolyl endopeptidase POP PREP Mus musculus
mycpa-q73sx2 Mycobacterium paratuberculosis hypothetical protein Mycobacterium paratuberculosis
myctu-RV0457C Mycobacterium tuberculosis and Mycobacterium bovis prolyl oligopeptidase family protein 74.5 kda RV0457C Mycobacterium tuberculosis
mycvi-a4t2y2 Mycobacterium gilvum (Mycobacterium flavescens), Mycobacterium sp., prolyl oligopeptidase, n-terminal beta-propeller Mycobacterium gilvum PYR-GCK
mycvn-q267q6 Mycobacterium vanbaalenii PYR-1 prolyl oligopeptidase precursor (EC 3.4.21.26) Mycobacterium vanbaalenii PYR-1
myxxa-PEP Myxococcus xanthus prolyl endopeptidase precursor pep Myxococcus xanthus
neime-NMB1877 Neisseria meningitidis, Neisseria gonorrhoeae, N. lactamica, N. sicca, N. polysaccharea, N. cinerea, N. mucosa, N. flavescens, N. subflava, prolyl oligopeptidase family protein Neisseria meningitidis
nocfa-q5ynx0 Nocardia farcinica putative peptidase Nocardia farcinica
novad-q2g5b2 Novosphingobium aromaticivorans (strain DSM 12444) prolyl oligopeptidase precursor (EC 3.4.21.26) Novosphingobium aromaticivorans
novad-q2g5b3 Novosphingobium aromaticivorans (strain DSM 12444) prolyl oligopeptidase precursor (EC 3.4.21.26) Novosphingobium aromaticivorans
orysa-Q658B2 Oryza sativa subsp. indica subsp. japonica (Rice) putative prolyl endopeptidase Oryza sativa
orysa-q7xsq2 Oryza sativa subsp. indica subsp. japonica (Rice) osjnba0084k11.14 protein Oryza sativa
pelld-q3b4s7 Pelodictyon luteolum (strain DSM 273) (Chlorobium luteolum strain DS273 prolyl oligopeptidase precursor (EC 3.4.21.26) Pelodictyon luteolum
prb01-Q9F7Q5 Gamma-proteobacterium EBAC31A08 predicted prolyl endopeptidase uncultured proteobacterium EBAC31A08
proae-q3vvf8 Prosthecochloris aestuarii DSM 271 prolyl oligopeptidase precursor (EC 3.4.21.26) Prosthecochloris aestuarii DSM 271
psea6-q15s45 Pseudoalteromonas atlantica (strain T6c \/ ATCC BAA-1087) prolyl oligopeptidase precursor (EC 3.4.21.26) Pseudoalteromonas atlantica T6c
pseht-q3ikv5 Pseudoalteromonas haloplanktis (strain TAC 125) prolyl endopeptidase (EC 3.4.21.26) Pseudoalteromonas haloplanktis
pyrab-PAB0762 Pyrococcus abyssi prolyl endopeptidase Pyrococcus abyssi
pyrfu-Q51714 Pyrococcus furiosus prolyl endopeptidase Pyrococcus furiosus
pyrho-PH1262 Pyrococcus horikoshii 617aa long hypothetical prolyl endopeptidase Pyrococcus horikoshii
pyrko-q5jd37 Pyrococcus kodakaraensis (Thermococcus kodakaraensis) prolyl endopeptidase Pyrococcus kodakaraensis
ratno-RPOP Rattus norvegicus (Rat) Prolyl endopeptidase rPop Rattus norvegicus
rhiec-q2ka74 Rhizobium etli (strain CFN 42 \/ ATCC 51251) putative peptidase protein Rhizobium etli
rhil3-q1miz0 Rhizobium leguminosarum bv. viciae (strain 3841) putative prolyl endopeptidase (EC 3.4.21.26) Rhizobium leguminosarum bv. viciae
rhisn-y4na Rhizobium sp. (strain NGR234) probable peptidase y4na (EC 3.4.21.-) Rhizobium sp.
rhoba-q7uit3 Rhodopirellula baltica prolyl endopeptidase (EC 3.4.21.26) Rhodopirellula baltica
rhop5-q07r86 Rhodopseudomonas palustris (strain BisA53) prolyl oligopeptidase (EC 3.4.21.26) Rhodopseudomonas palustris BisA53
rhopb-q218p9 Rhodopseudomonas palustris (strain BisB18) peptidase s9, prolyl oligopeptidase active site region Rhodopseudomonas palustris
ricpr-y174 Rickettsia prowazekii probable peptidase rp174 (EC 3.4.21.-) Rickettsia prowazekii
ricty-q68xj3 Rickettsia typhi prolyl oligopeptidase family protein (EC 3.4.21.26) Rickettsia typhi
schja-q5c1s0 Schistosoma japonicum (Blood fluke, platyhelminth) hypothetical protein Schistosoma japonicum
shefr-q3nsv1 Shewanella frigidimarina NCIMB 400 prolyl oligopeptidase precursor (EC 3.4.21.26) Shewanella frigidimarina NCIMB 400
sheon-SO2047 Shewanella oneidensis (and Shewanella sp. MR-4, Shewanella putrefaciens CN-32 Shewanella sp. MR-7 Shewanella sp. ANA-3) prolyl oligopeptidase family protein Shewanella oneidensis
sheon-SO2753 Shewanella oneidensis, Shewanella baltica, Shewanella sp., Shewanella putrefaciens, prolyl endopeptidase Shewanella oneidensis
solus-q43vk0 Solibacter usitatus Ellin6076 prolyl oligopeptidase (EC 3.4.21.26) Solibacter usitatus Ellin6076
sphca-Q9ZNM8 Sphingomonas capsulata (Flavobacterium capsulata)prolyl oligopeptidase precursor (EC 3.4.21.26) (PE) Sphingomonas capsulata
sulto-ST0002 Sulfolobus tokodaii putative prolyl endopeptidase Sulfolobus tokodaii
pig-ppce Pig prolyl endopeptidase Sus scrofa
synja-q2jrs3 Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime) prolyl oligopeptidase (EC 3.4.21.26) Synechococcus sp.
synjb-q2jit4 Synechococcus sp. (strain JA-2-3B'a(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime) prolyl oligopeptidase (EC 3.4.21.26) Synechococcus sp.
tetng-q4rkk3 Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis) hypothetical protein (fragment) Tetraodon nigroviridis
tetng-q4s6t6 Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis) hypothetical protein (fragment) Tetraodon nigroviridis
thefy-q47ms4 Thermobifida fusca (strain YX) prolyl oligopeptidase (EC 3.4.21.26) Thermobifida fusca
thefy-q47nt0 Thermobifida fusca (strain YX) prolyl oligopeptidase (EC 3.4.21.26) Thermobifida fusca
trede-q73nf8 Treponema denticola prolyl endopeptidase (EC 3.4.21.26) Treponema denticola
trier-q3hef0 Trichodesmium erythraeum IMS101 prolyl oligopeptidase (EC 3.4.21.26) Trichodesmium erythraeum IMS101
tryb2-q6ha27 Trypanosoma brucei prolyl oligopeptidase (EC 3.4.21.26) Trypanosoma brucei
trycr-TCPO Trypanosoma cruzi Trypanosoma cruzi 80 kDa prolyl oligopeptidase (TCPO) mRNA, (EC 3.4.21.26) Trypanosoma cruzi
ustma-q4p3m5 Ustilago maydis (strain 521 \/ FGSC 9021) (Corn smut fungus) Prolyl endopeptidase Ustilago maydis 521
vibf1-q5e5s9 Vibrio fischeri (strain ATCC 700601 \/ ES114) prolyl endopeptidase (EC 3.4.21.26) Vibrio fischeri
vibpa-VPA0468 Vibrio parahaemolyticus, Vibrionales bacterium, Vibrio alginolyticus, Vibrio sp., prolyl endopeptidase Vibrio parahaemolyticus
vibpa-VPA1496 Vibrio parahaemolyticus, Vibrio alginolyticus, Vibrio harveyi, Vibrio sp. prolyl endopeptidase Vibrio parahaemolyticus
vibvu-VV20795 Vibrio vulnificus and strain YJ016 serine protease of the peptidase family s9a Vibrio vulnificus
xanax-XAC0628 Xanthomonas axonopodis, Xanthomonas campestris, Xanthomonas oryzae, Xanthomonas fuscans, Xanthomonas vesicatoria, Xanthomonas perforans, Xanthomonas gardneri, prolyl oligopeptidase Xanthomonas axonopodis
xenla-ppce Xenopus laevis (African clawed frog) similar to prolyl endopeptidase (fragment) Xenopus laevis
xentr-q6p4w3 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) hypothetical protein mgc76255 Xenopus tropicalis
zymmo-q5npe2 Zymomonas mobilis prolyl oligopeptidase family protein Zymomonas mobilis
amabi-popb Amanita bisporigera (Destroying angel). Toxin-processing prolyl oligopeptidase Amanita bisporigera
amabi-popa Amanita bisporigera (Destroying angel). Prolyl oligopeptidase A Amanita bisporigera
galm3-popa Galerina marginata (strain CBS 339.88). Prolyl oligopeptidase A Galerina marginata

Gene_locus_frgt Name Species
ricco-RC0215 Rickettsia conorii and Rickettsia sibirica similarity to prolyl endopeptidase Rickettsia conorii
ricfe-q4ukh6 Rickettsia felis (Rickettsia azadi) prolyl endopeptidase (EC 3.4.21.26) Rickettsia felis
spofr-Q8ISQ9 Spodoptera frugiperda (Fall armyworm) prolyl endopeptidase (fragment) Spodoptera frugiperda

Substrate Chemical Nomenclature Proteins
Omphalotin-A (3S,6S,9S,12S,15S,21S,24S,30S,33S)-9,21,30-tris[(2S)-butan-2-yl]-15-(1H-indol-3-ylmethyl)-1,4,7,13,19,22,28,31,34-nonamethyl-3,6,12,24,33-penta(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31,34-dodecazacyclohexatriacontane-2,5,8,11,14,17,20,23,26,29,32,35-dodecone ompol-OphP
OphMA-core-peptide-15mer ompol-OphP
OphMA-core-peptide-18mer ompol-OphP
Abz-GLY-PHE-GLY-PRO-PHE-GLY N-(2-Aminobenzoyl)glycyl-L-phenylalanylglycyl-L-prolyl-N-(2-oxoethyl)-L-phenylalaninamide pig-ppce
Gly-Phe-Arg-Pro 1-[2-[[2-[(2-aminoacetyl)amino]-3-phenylpropanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]pyrrolidine-2-carboxylic acid pig-ppce
Gly-Phe-Glu-Pro 1-[2-[[2-[(2-aminoacetyl)amino]-3-phenylpropanoyl]amino]-4-carboxybutanoyl]pyrrolidine-2-carboxylic acid pig-ppce
Glu-Phe-Ser-Pro 1-[2-[[2-[(2-amino-4-carboxybutanoyl)amino]-3-phenylpropanoyl]amino]-3-hydroxypropanoyl]pyrrolidine-2-carboxylic acid pig-ppce
Alpha-amanitin-proprotein 9agar-h2e7q8
Z-Gly-Pro-pNA benzyl N-[2-[(2S)-2-[(4-nitrophenyl)carbamoyl]pyrrolidin-1-yl]-2-oxoethyl]carbamate 9gamm-MaPOP
Z-Gly-Pro-AMC benzyl N-[2-[(2S)-2-[(4-methyl-2-oxochromen-7-yl)carbamoyl]pyrrolidin-1-yl]-2-oxoethyl]carbamate human-FAP

Inhibitor Chemical Nomenclature Proteins
spiro-b-lactam-pyrroloquinoline-6b pig-ppce
Presegetalin-B1 MSPILAHDVVKPQGVAWAFQAKDVENASAPV 9cary-r4p353
Presegetalin-A1 MSPILAHDVVKPQGVPVWAFQAKDVENASAPV 9cary-r4p353
Presegetalin-F1 MATSFQFDGLKPSFSASYSSKPIQTQVSNGMDNASAPV 9cary-r4p353
Follower-Peptide-Presegetalin-A1 GVPVWAFQAKDVENASAPV 9cary-r4p353
ArM-dirhodium-cofactor pyrfu-Q51714
SUAM-14746 1-[(2~{S})-4-hydroxy-2-(1,3-thiazolidine-3-carbonyl)pyrrolidin-1-yl]-4-[2-[(~{E})-2-phenylethenyl]phenoxy]butan-1-one haldh-a0a1x9t5x9    human-PREP
N-acyl-prolylpyrrolidine-inhibitor-1 1-[(2S,4S)-4-azido-2-[(2S)-2-methanimidoylpyrrolidine-1-carbonyl]pyrrolidin-1-yl]-4-phenylbutan-1-one pig-ppce
N-acyl-prolylpyrrolidine-inhibitor-2 tert-butyl N-[[1-[(3S,5S)-5-[(2S)-2-[(R)-amino(hydroxy)methyl]pyrrolidine-1-carbonyl]-1-(4-phenylbutanoyl)pyrrolidin-3-yl]triazol-4-yl]methyl]carbamate pig-ppce
N-acyl-prolylpyrrolidine-inhibitor-3 1-[(2S,4S)-4-[4-(4-fluorophenyl)triazol-1-yl]-2-(pyrrolidine-1-carbonyl)pyrrolidin-1-yl]-4-phenylbutan-1-one pig-ppce
Z-Pro-Prolinal-IC1 1-[(2R,5S)-2-tert-butyl-5-[(2S)-2-[(1R)-1,2-dihydroxyethyl]pyrrolidine-1-carbonyl]pyrrolidin-1-yl]-4-phenylbutan-1-one pig-ppce
Z-Pro-Prolinal-IC2 (5R)-N-benzyl-5-[(2S)-2-[(1R)-1,2-dihydroxyethyl]pyrrolidine-1-carbonyl]cyclopentene-1-carboxamide pig-ppce
Z-Pro-Prolinal-IC3 (2S)-1-[(2S)-1-(4-phenylbutanoyl)pyrrolidine-2-carbonyl]pyrrolidine-2-carbonitrile pig-ppce
Z-Pro-Prolinal-IC4 (2S)-N-benzyl-2-[(2S)-2-[(1R)-1,2-dihydroxyethyl]pyrrolidine-1-carbonyl]pyrrolidine-1-carboxamide pig-ppce
Z-Pro-Prolinal-derived benzyl (2S)-2-[(2S)-2-(hydroxymethyl)piperidine-1-carbonyl]pyrrolidine-1-carboxylate pig-ppce
R-Pro-(decarboxy-Pro)-X99 2-[3-[(2S)-4,4-difluoro-2-(pyrrolidine-1-carbonyl)pyrrolidin-1-yl]-3-oxopropyl]isoindole-1,3-dione pig-ppce
R-Pro-(decarboxy-Pro)-X98 1-[3-oxo-3-[(2S)-2-(pyrrolidine-1-carbonyl)pyrrolidin-1-yl]propyl]-3-phenylquinoxalin-2-one pig-ppce
R-Pro-(decarboxy-Pro)-X97 3-[4-oxo-4-[(2S)-2-(pyrrolidine-1-carbonyl)pyrrolidin-1-yl]butyl]-5,5-diphenylimidazolidine-2,4-dione pig-ppce
Polyozellin (12-acetyloxy-6,7,16,17-tetrahydroxy-3,20-dioxapentacyclo[11.7.0.02,10.04,9.014,19]icosa-1(13),2(10),4,6,8,11,14,16,18-nonaen-11-yl) acetate human-PREP
CHEMBL4576969 (2-methylsulfanylphenyl)-[(2R)-2-[(1S,2S,6R,8S)-2,9,9-trimethyl-3,5-dioxa-4-boratricyclo[6.1.1.02,6]decan-4-yl]pyrrolidin-1-yl]methanone human-PREP
CHEMBL4559324 N-[3-methoxy-4-[(2R)-2-[(1S,2S,6R,8S)-2,9,9-trimethyl-3,5-dioxa-4-boratricyclo[6.1.1.02,6]decan-4-yl]pyrrolidine-1-carbonyl]phenyl]acetamide human-PREP
DB07148 (6S)-1-chloro-3-[(4-fluorophenyl)methoxy]-6-(pyrrolidine-1-carbonyl)-6H-pyrrolo[1,2-a]pyrazin-4-one human-PREP
2-(N-Morpholino)ethanesulfonic-acid 2-morpholin-4-ylethanesulfonic acid pseae-PA3859    9gamm-MaPOP
Z-Ala_prolinal (2S)-1-[(2S)-2-(phenylmethoxycarbonylamino)propanoyl]pyrrolidine-2-carboxylic acid myxxa-PEP
CHEMBL1086968 [(2S,3aS,7aS)-2-(1,3-thiazolidine-3-carbonyl)-2,3,3a,4,5,6,7,7a-octahydroindol-1-yl]-[(1R,2R)-2-phenylcyclopropyl]methanone human-PREP
ARI-3531 [(2S)-1-[(2R)-3-methyl-2-(pyridine-4-carbonylamino)butanoyl]pyrrolidin-2-yl]boronic acid human-PREP
Sin-Gly-Pro (2S)-1-[2-(3-carboxypropanoylamino)acetyl]pyrrolidine-2-carboxylic acid pig-ppce
Z-Pro-Prolinal benzyl (2S)-2-[(2S)-2-formylpyrrolidine-1-carbonyl]pyrrolidine-1-carboxylate pig-ppce    aerpu-PEP    9gamm-MaPOP
Z-Gly-Pro (2S)-1-[2-(phenylmethoxycarbonylamino)acetyl]pyrrolidine-2-carboxylic acid pig-ppce
NBD-HE-HP N-[2-[hexyl-(4-nitrophenoxy)phosphoryl]oxyethyl]-6-[(4-nitro-2,1,3-benzoxadiazol-7-yl)amino]hexanamide mouse-hslip    mouse-Ces1d    mouse-MGLL    mouse-ES10    mouse-Abhd11    drome-CG2059    mouse-lypla2    drome-CG18815    mouse-lypla1    mouse-Ces1c    mouse-Ces1f    mouse-PPME1    mouse-apeh    mouse-abhd5    drome-CG1882    mouse-lypl1    burce-lipaa    rhidl-lipas    drome-EST23aes07    drome-este6    drome-CG5355    drome-aes05    drome-aes02    drome-CG8425

References (6)

Title : The Dipeptidyl Peptidase Family, Prolyl Oligopeptidase, and Prolyl Carboxypeptidase in the Immune System and Inflammatory Disease, Including Atherosclerosis - Waumans_2015_Front.Immunol_6_387
Author(s) : Waumans Y , Baerts L , Kehoe K , Lambeir AM , De Meester I
Ref : Front Immunol , 6 :387 , 2015
Abstract :
PubMedSearch : Waumans_2015_Front.Immunol_6_387
PubMedID: 26300881

Title : Prolyl oligopeptidase binds to GAP-43 and functions without its peptidase activity - Di Daniel_2009_Mol.Cell.Neurosci_41_373
Author(s) : Di Daniel E , Glover CP , Grot E , Chan MK , Sanderson TH , White JH , Ellis CL , Gallagher KT , Uney J , Thomas J , Maycox PR , Mudge AW
Ref : Molecular & Cellular Neurosciences , 41 :373 , 2009
Abstract :
PubMedSearch : Di Daniel_2009_Mol.Cell.Neurosci_41_373
PubMedID: 19332125
Gene_locus related to this paper: mouse-ppce

Title : The prolyl oligopeptidase family - Polgar_2002_Cell.Mol.Life.Sci_59_349
Author(s) : Polgar L
Ref : Cell Mol Life Sciences , 59 :349 , 2002
Abstract :
PubMedSearch : Polgar_2002_Cell.Mol.Life.Sci_59_349
PubMedID: 11915948

Title : Catalysis of serine oligopeptidases is controlled by a gating filter mechanism - Fulop_2000_EMBO.Rep_1_277
Author(s) : Fulop V , Szeltner Z , Polgar L
Ref : EMBO Rep , 1 :277 , 2000
Abstract :
PubMedSearch : Fulop_2000_EMBO.Rep_1_277
PubMedID: 11256612
Gene_locus related to this paper: pig-ppce

Title : Prolyl oligopeptidase: an unusual beta-propeller domain regulates proteolysis - Fulop_1998_Cell_94_161
Author(s) : Fulop V , Bocskei Z , Polgar L
Ref : Cell , 94 :161 , 1998
Abstract :
PubMedSearch : Fulop_1998_Cell_94_161
PubMedID: 9695945
Gene_locus related to this paper: pig-ppce

Title : Structural relationship between lipases and peptidases of the prolyl oligopeptidase family - Polgar_1992_FEBS.Lett_311_281
Author(s) : Polgar L
Ref : FEBS Letters , 311 :281 , 1992
Abstract :
PubMedSearch : Polgar_1992_FEBS.Lett_311_281
PubMedID: 1397329