vigra-e5l4l1

Vigna radiata (Mung bean) Epoxide hydrolase A

Comment

Relationship

Family : Epoxide_hydrolase

Block : X

Position in NCBI Life Tree : Vigna radiata

Molecular evidence

No mutation

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MEEIEHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSW
RHQILALSSR GYRAVAPDLRGYGDTEAPESISSYTIMHL
VGDIVALIDSLGVGQVFLVAH DWGAIVGWYLCLFRPEKI
KAYVCLSVPFMPRNPKVRPVDAMRALYGDDYY ICRFQEP
GKAEALYGSNNNIGEVIKSILTNRRPGPPILPKEGVALPS
GSL PSRPLPSWLSEEDVTYYASKFSKTGLTGGLNYYRNL
NLNWELTAAWTGAK VKVPVKFITGDLDVVYTSLGIKDYI
DSGAFKRDVHYLEEVVVQEGVAHFN NQEAAEDISNHIYE
FIKKF

References

Title : Heterologous overexpression of Vigna radiata epoxide hydrolase in Escherichia coli and its catalytic performance in enantioconvergent hydrolysis of p-nitrostyrene oxide into (R)-p-nitrophenyl glycol - Zhu_2014_Appl.Microbiol.Biotechnol_98_207
Author(s) : Zhu QQ , He WH , Kong XD , Fan LQ , Zhao J , Li SX , Xu JH
Ref : Applied Microbiology & Biotechnology , 98 :207 , 2014
Abstract : Zhu_2014_Appl.Microbiol.Biotechnol_98_207
ESTHER : Zhu_2014_Appl.Microbiol.Biotechnol_98_207
PubMedSearch : Zhu_2014_Appl.Microbiol.Biotechnol_98_207
PubMedID: 23615737
Gene_locus related to this paper: vigra-e5l4l1