Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9actn-k4mhv9

Streptomyces sp. BC16019 BotH bottromycin epimerase

Relationship
Family|BotH
Block| X
Position in NCBI Life Tree|Streptomyces sp. BC16019
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > unclassified Streptomyces: N E > Streptomyces sp. BC16019: N E


Molecular evidence
Database
No mutation
5 structures (e.g. : 6T6H, 6T6X, 6T6Y... more)
No kinetic





4 substrates (e.g. : Bottromycin-A2, Bottromycin-A2-MKW, Bottromycin-A2-derivative-MQZ... more)
No inhibitor
1 Genbank : AFV25485
1 UniProt : K4MHV9
>3 Structure links 2 more: 6T6Z, 6T6X, 6T6Y
1 UniProt : K4MHV9
1 Interpro : K4MHV9
1 Prodom : K4MHV9
1 Pfam : K4MHV9
1 PIRSF : K4MHV9
1 SUPERFAM : K4MHV9
Sequence
Graphical view for this peptide sequence: 9actn-k4mhv9
Colored MSA for BotH (raw)
MRDGNGTSRRDVFEVFSRDGTPIRGFSRPGPGETVVLVHGVAMDRRIWAE
SGFLDALPDAHVLALDLRGRGESGRVGTAEGHALRRYVEDVRAVLDRFGR
ARYSLFGTFFGGRIALQVAAVDTRVARAFSFCAHAEQVEIPEDAVEEEAV
AVEGPGGHAYLRDHFTGRGAPPWMVEACARVDPGELGAATRGLLHGSDRR
TERGHPDQELVLITADGDADLAPFHAGERRLGAHLWLVDAPTRIKAAGRL
AEVGRRVAGVLAEGGHGTGDAPAEARTTGDAPAEARASGTGVV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRDGNGTSRRDVFEVFSRDGTPIRGFSRPGPGETVVLVHGVAMDRRIWAE
SGFLDALPDAHVLALDLRGRGESGRVGTAEGHALRRYVEDVRAVLDRFGR
ARYSLFGTFFGGRIALQVAAVDTRVARAFSFCAHAEQVEIPEDAVEEEAV
AVEGPGGHAYLRDHFTGRGAPPWMVEACARVDPGELGAATRGLLHGSDRR
TERGHPDQELVLITADGDADLAPFHAGERRLGAHLWLVDAPTRIKAAGRL
AEVGRRVAGVLAEGGHGTGDAPAEARTTGDAPAEARASGTGVV


Reference
    Title: The bottromycin epimerase BotH defines a group of atypical alpha/beta-hydrolase-fold enzymes
    Sikandar A, Franz L, Adam S, Santos-Aberturas J, Horbal L, Luzhetskyy A, Truman AW, Kalinina OV, Koehnke J
    Ref: Nat Chemical Biology, 16:1013, 2020 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer