Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9acto-C6ZCS0

Streptomyces griseochromogenes Type I modular polyketide synthase

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Streptomyces griseochromogenes
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces griseochromogenes: N E


Molecular evidence
Database
No mutation
1 structure:
3LCR: Thioesterase from Tautomycetin Biosynthetic Pathway
No kinetic





No Substrate
No inhibitor
1 Genbank : EU035755
1 UniProt : C6ZCS0
1 Structure : 3LCR
1 UniProt : C6ZCS0
1 Interpro : C6ZCS0
1 Prodom : C6ZCS0
1 Pfam : C6ZCS0
1 PIRSF : C6ZCS0
1 SUPERFAM : C6ZCS0
Sequence
Graphical view for this peptide sequence: 9acto-C6ZCS0
Colored MSA for Thioesterase (raw)
LVREAVAAVLGHAPGTQVDDEQPFKELGFDSLTAVELRNVLQTRTGVGLA
AGVVFDHPDPRSLAKALAAALRPADHAEPQEAQSDYFGELFLQAMRTGEL
AQAQQLMAGAAQLRLKYGDPAGPEAVPEIVRLGRGQLGPQLILVCPTVMT
TGPQVYSRLAEELDAGRRVSALVPPGFHGGQALPATLTVLVRSLADVVQA
EVADGEFALAGHSSGGVVAYEVARELEARGLAPRGVVLIDSYSFDGDGGR
PEELFRSALNERFVEYLRLTGGGNLSQRITAQVWCLELLRGWRPEGLTAP
TLYVRPAQPLVEQEKPEWRGDVLAAMGQVVEAPGDHFTIIEGEHVASTAH
IVGDWLREAHAHYSTEGWGGGLRTEE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

LVREAVAAVLGHAPGTQVDDEQPFKELGFDSLTAVELRNVLQTRTGVGLA
AGVVFDHPDPRSLAKALAAALRPADHAEPQEAQSDYFGELFLQAMRTGEL
AQAQQLMAGAAQLRLKYGDPAGPEAVPEIVRLGRGQLGPQLILVCPTVMT
TGPQVYSRLAEELDAGRRVSALVPPGFHGGQALPATLTVLVRSLADVVQA
EVADGEFALAGHSSGGVVAYEVARELEARGLAPRGVVLIDSYSFDGDGGR
PEELFRSALNERFVEYLRLTGGGNLSQRITAQVWCLELLRGWRPEGLTAP
TLYVRPAQPLVEQEKPEWRGDVLAAMGQVVEAPGDHFTIIEGEHVASTAH
IVGDWLREAHAHYSTEGWGGGLRTEE


References
    Title: Biochemical and structural characterization of the tautomycetin thioesterase: analysis of a stereoselective polyketide hydrolase
    Scaglione JB, Akey DL, Sullivan R, Kittendorf JD, Rath CM, Kim ES, Smith JL, Sherman DH
    Ref: Angew Chem Int Ed Engl, 49:5726, 2010 : PubMed

            

    Title: Characterization of the tautomycetin biosynthetic gene cluster from Streptomyces griseochromogenes provides new insight into dialkylmaleic anhydride biosynthesis
    Li W, Luo Y, Ju J, Rajski SR, Osada H, Shen B
    Ref: Journal of Natural Products, 72:450, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer