Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9acto-c0jrv0

Streptomyces sioyaensis Sio2

Relationship
Family|A85-Mycolyl-transferase
Block| X
Position in NCBI Life Tree|Streptomyces sioyaensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces sioyaensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : FJ436355
1 UniProt : C0JRV0
1 UniProt : C0JRV0
1 Interpro : C0JRV0
1 Prodom : C0JRV0
1 Pfam : C0JRV0
1 PIRSF : C0JRV0
1 SUPERFAM : C0JRV0
Sequence
Graphical view for this peptide sequence: 9acto-c0jrv0
Colored MSA for A85-Mycolyl-transferase (raw)
MSPGVPRGWAPSSVLARAARGGSEVENGGKHMKILSRAGLRGWGAAFVGL
VALLGMVGPAAPAAQAATAPPHFADGFGLTVVSQPKWAGPEKRTFVVTVK
SRQVPTYDAMKGQVPGEHVLMVTLPTGYNGAAATRYPVLYHLHGAGDLPN
SLWTKTIAEHATKGVPLITVSPNGGGHGWYANWRNPGPRGRQNWETFHLK
QVIPFIDANLKTIAARAGRAIVGHSMGGFGAIHYAEDRPDLFRYAGSFSA
DLDLRSPWGRGAVVGSGVVPAYGKPYAAPDAIFGSPLWPLDGAWNAASPA
HHVTALRGMGVAMYSGDGGNLLDNPVQAAVEKGAQVTTATMAAHLKSSGI
PYRFVDYGDGSRWAKGCTGKHAQFPCLQADMNDYVKLIMKRLRHP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSPGVPRGWAPSSVLARAARGGSEVENGGKHMKILSRAGLRGWGAAFVGL
VALLGMVGPAAPAAQAATAPPHFADGFGLTVVSQPKWAGPEKRTFVVTVK
SRQVPTYDAMKGQVPGEHVLMVTLPTGYNGAAATRYPVLYHLHGAGDLPN
SLWTKTIAEHATKGVPLITVSPNGGGHGWYANWRNPGPRGRQNWETFHLK
QVIPFIDANLKTIAARAGRAIVGHSMGGFGAIHYAEDRPDLFRYAGSFSA
DLDLRSPWGRGAVVGSGVVPAYGKPYAAPDAIFGSPLWPLDGAWNAASPA
HHVTALRGMGVAMYSGDGGNLLDNPVQAAVEKGAQVTTATMAAHLKSSGI
PYRFVDYGDGSRWAKGCTGKHAQFPCLQADMNDYVKLIMKRLRHP


Reference
    Title: Thiopeptide biosynthesis featuring ribosomally synthesized precursor peptides and conserved posttranslational modifications
    Liao R, Duan L, Lei C, Pan H, Ding Y, Zhang Q, Chen D, Shen B, Yu Y, Liu W
    Ref: Chemical Biology, 16:141, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer