Gene_locus Report for: 9acto-d1xth7Streptomyces sp. ACTE Putative esterase Comment Other strains: Streptomyces sp. DpondAA-E10; SID8360; SID8358 (strain SirexAA-E / ActE) Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces sp. SirexAA-E: N E
6_AlphaBeta_hydrolase : 9acto-d1xdv2Streptomyces sp. ACTE Alpha/beta hydrolase fold-1, 9acto-d1xev0Streptomyces sp. ACTE Alpha/beta hydrolase fold protein, 9acto-d1xu00Streptomyces sp. ACTE Alpha/beta hydrolase fold protein. A85-IroE-IroD-Fes-Yiel : 9acto-d1xhu0Streptomyces sp. ACTE Putative esterase, 9acto-d1xjb0Streptomyces sp. ACTE Putative esterase. Aclacinomycin-methylesterase_RdmC : 9acto-d1xnm4Streptomyces sp. ACTE Alpha/beta hydrolase fold protein. CFTR-inhibitory-factor_Cif : 9acto-d1xli1Streptomyces sp. ACTE Alpha/beta hydrolase fold protein. Epoxide_hydrolase : 9acto-d1xdu4Streptomyces sp. ACTE Alpha/beta hydrolase fold protein, 9acto-d1xjx7Streptomyces sp. ACTE Alpha/beta hydrolase fold protein, 9acto-d1xkq2Streptomyces sp. ACTE Alpha/beta hydrolase fold protein, 9acto-d1xls5Streptomyces sp. ACTE Alpha/beta hydrolase fold protein, 9acto-d1xm21Streptomyces sp. ACTE Hydrolase or acyltransferase (Alpha/beta hydrolase superfamily)-like protein, 9acto-d1xnd7Streptomyces sp. ACTE Alpha/beta hydrolase fold protein. Haloacetate_dehalogenase : 9acto-d1xj46Streptomyces sp. ACTE Alpha/beta hydrolase fold protein, 9acto-d1xn59Streptomyces sp. ACTE Alpha/beta hydrolase fold protein. Haloalkane_dehalogenase-HLD1 : 9acto-d1xj60Streptomyces sp. ACTE Alpha/beta hydrolase fold protein. Haloperoxidase : 9acto-d1xnc6Streptomyces sp. ACTE Alpha/beta hydrolase fold protein. HNLyase_Bact : 9acto-d1xlp3Streptomyces sp. ACTE Putative uncharacterized protein, 9acto-d1xsp3Streptomyces sp. ACTE Putative esterase. Lipase_2 : 9acto-d1xmc4Streptomyces sp. ACTE Lipase class 2. Proline_iminopeptidase : 9acto-d1xph3Streptomyces sp. ACTE Proline-specific peptidase Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Streptomyces sp. DpondAA-E10: N, E.
Streptomyces sp. SID8360: N, E.
Streptomyces sp. SID8358: N, E.
Streptomyces sp. SirexAA-E: N, E.
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
1 Genbank : WP_0140467023 UniProt : G2NCL2, A0A327SGP1, A0A6G2ZJI13 Interpro : G2NCL2, A0A327SGP1, A0A6G2ZJI13 Pfam : G2NCL2, A0A327SGP1, A0A6G2ZJI13 PIRSF : G2NCL2, A0A327SGP1, A0A6G2ZJI13 SUPERFAM : G2NCL2, A0A327SGP1, A0A6G2ZJI1
|
Sequence Graphical view for this peptide sequence: 9acto-d1xth7 Colored MSA for A85-Est-Putative (raw)
MGLTSNAVLAVAVSLAVGLFAVTIWLWPRLAARSAAAVAGRVGLLLATQL
LVFVSVALLANHSFLFYGSWADLWGRQQELGTVVDHSAATGASQGVVRTG
ALRPDVPGGSRPSAVGRIDKVAVSGSVSGIDSPAYVYLPPEYFQPAYARR
TFPAVVVLTGYPGTAENLIKGLRYPRTAQERVRAGTAQPMILVMLRPTVA
PPRDTECVDIKGGPQTETFFAEDLPKAVARTYRVGDRARNWGVMGNSTGG
YCALKLGLHHPERFAASAGLSAYYKAAEDPTTGDLFHGDGAARRRADLLW
SLDHRTPAASSFLVTSSLKGEGNLRATRDFIDRVKAPARVSSIVLDSGGH
NFNTWRREIPGALEWMSGRLTAD
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MGLTSNAVLAVAVSLAVGLFAVTIWLWPRLAARSAAAVAGRVGLLLATQL LVFVSVALLANHSFLFYGSWADLWGRQQELGTVVDHSAATGASQGVVRTG ALRPDVPGGSRPSAVGRIDKVAVSGSVSGIDSPAYVYLPPEYFQPAYARR TFPAVVVLTGYPGTAENLIKGLRYPRTAQERVRAGTAQPMILVMLRPTVA PPRDTECVDIKGGPQTETFFAEDLPKAVARTYRVGDRARNWGVMGNSTGG YCALKLGLHHPERFAASAGLSAYYKAAEDPTTGDLFHGDGAARRRADLLW SLDHRTPAASSFLVTSSLKGEGNLRATRDFIDRVKAPARVSSIVLDSGGH NFNTWRREIPGALEWMSGRLTAD
|
|
|