Gene_locus Report for: 9acto-d1xu00Streptomyces sp. ACTE Alpha/beta hydrolase fold protein Comment Other strains: Streptomyces sp. DpondAA-E10; SID8360; SID8358 (strain SirexAA-E / ActE) Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces sp. SirexAA-E: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Streptomyces sp. DpondAA-E10: N, E.
Streptomyces sp. SID8360: N, E.
Streptomyces sp. SID8358: N, E.
Streptomyces sp. SirexAA-E: N, E.
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
1 Genbank : WP_014049057>3 UniProt links 1 more: G2NMM6, A0A327TQZ3, A0A6G2ZA03<4 UniProt links 1 less: G2NMM6, A0A327TQZ3, A0A6G2ZA03, A0A7K2TPX2>3 Interpro links 1 more: G2NMM6, A0A327TQZ3, A0A6G2ZA03<4 Interpro links 1 less: G2NMM6, A0A327TQZ3, A0A6G2ZA03, A0A7K2TPX2>3 Pfam links 1 more: G2NMM6, A0A327TQZ3, A0A6G2ZA03<4 Pfam links 1 less: G2NMM6, A0A327TQZ3, A0A6G2ZA03, A0A7K2TPX2>3 PIRSF links 1 more: G2NMM6, A0A327TQZ3, A0A6G2ZA03<4 PIRSF links 1 less: G2NMM6, A0A327TQZ3, A0A6G2ZA03, A0A7K2TPX2>3 SUPERFAM links 1 more: G2NMM6, A0A327TQZ3, A0A6G2ZA03<4 SUPERFAM links 1 less: G2NMM6, A0A327TQZ3, A0A6G2ZA03, A0A7K2TPX2
|
Sequence Graphical view for this peptide sequence: 9acto-d1xu00
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MSEVLLSAGVVEYEDTGGDGPVVVLLHGVAMNGSLWRHVVAGLGADFRCV
VPTLPLGGHRRPMLPDADLTVRGVARLVAEFLDALGLQDVTLVMNDWGGA
QFLVADGRDRRIGRLVLTSCEAFGNFPPGLPGRNLYLAAKVPGGLRLAFA
LLKLKPLRRLPVTWGWMSKRPVPPEVMDEWFRPLWTSAAIRRDLRAYALG
VPPERELLEWAEALRTFDRPALVVWATEDKVMPPSHGRRLAGLLPRGELV
EVEDSYTLIPQDRPERLCEALRAFVPRPS
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MSEVLLSAGVVEYEDTGGDGPVVVLLHGVAMNGSLWRHVVAGLGADFRCV
VPTLPLGGHRRPMLPDADLTVRGVARLVAEFLDALGLQDVTLVMNDWGGA
QFLVADGRDRRIGRLVLTSCEAFGNFPPGLPGRNLYLAAKVPGGLRLAFA
LLKLKPLRRLPVTWGWMSKRPVPPEVMDEWFRPLWTSAAIRRDLRAYALG
VPPERELLEWAEALRTFDRPALVVWATEDKVMPPSHGRRLAGLLPRGELV
EVEDSYTLIPQDRPERLCEALRAFVPRPS
|
|
|
|
