Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9acto-e2sft4

Aeromicrobium marinum DSM 15272 Uncharacterized protein

Comment
only c-term Pfam A Cutinase 344 546


Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Aeromicrobium marinum DSM 15272
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Propionibacteriales: N E > Nocardioidaceae: N E > Aeromicrobium: N E > Aeromicrobium marinum: N E > Aeromicrobium marinum DSM 15272: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : ACLF03000014
1 UniProt : E2SFT4
1 UniProt : E2SFT4
1 Interpro : E2SFT4
1 Prodom : E2SFT4
1 Pfam : E2SFT4
1 PIRSF : E2SFT4
1 SUPERFAM : E2SFT4
Sequence
Graphical view for this peptide sequence: 9acto-e2sft4
Colored MSA for Cutinase (raw)
LVGVRGSGEFPQGPDPSTPALFWSDEIGFGVPNHTIATTVVERIRQQRPS
ATVKLVAVQYLALRVPTYDPDVDYGMFVDSVFDGVDKVRQLVEAEAVRCP
SSRFVLIGASQGALVLHMALPTLVEQHERDRIAGVVLLANPARVAGSTET
LWQSAGVPAVDGVRDASGSWTGFYPGIDAPIPPWAAARTITLCRQGDVVC
AFRPGATMGPHLTYSTEDLQSVAVWQGARVAADLPED
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

LVGVRGSGEFPQGPDPSTPALFWSDEIGFGVPNHTIATTVVERIRQQRPS
ATVKLVAVQYLALRVPTYDPDVDYGMFVDSVFDGVDKVRQLVEAEAVRCP
SSRFVLIGASQGALVLHMALPTLVEQHERDRIAGVVLLANPARVAGSTET
LWQSAGVPAVDGVRDASGSWTGFYPGIDAPIPPWAAARTITLCRQGDVVC
AFRPGATMGPHLTYSTEDLQSVAVWQGARVAADLPED



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer