Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9acto-q6v1n7

Streptomyces sp. HK803 plm7

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Streptomyces sp. HK803
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces sp. HK803: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AY354515
1 UniProt : Q6V1N7
1 UniProt : Q6V1N7
1 Interpro : Q6V1N7
1 Prodom : Q6V1N7
1 Pfam : Q6V1N7
1 PIRSF : Q6V1N7
1 SUPERFAM : Q6V1N7
Sequence
Graphical view for this peptide sequence: 9acto-q6v1n7
Colored MSA for Thioesterase (raw)
IALDQPLVELGFDSLSAVQVRNKLGLATGLSLPAMLVFDHPTVTAVRDFL
AAELDGAGHDRTAQKTGEGHEDLVSGADESFAAIYRKVALRGRMEEVEDL
LGSASGLRARFSGASEAPDGTRFVRLATGGQGPAVISFPPFAPVEQTLQF
VRLASFFRDRRDLSMVTVPGFLKGEPLAESVDVLIDVLAESAIHCAAGSP
FALLGYSSSGWLAHCVTARMEALGTPAQGLVLLDTYLPDGMSVALRQAMT
YEVNERRSRFTKLNFTTITALGTYRRMFRGWAPQPVSTPTLFIRPEECIP
GDPGLPPLTGEWRTHWPLPHTDATVPGDHCTIVAENADATAALVHDWLDA
L
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

IALDQPLVELGFDSLSAVQVRNKLGLATGLSLPAMLVFDHPTVTAVRDFL
AAELDGAGHDRTAQKTGEGHEDLVSGADESFAAIYRKVALRGRMEEVEDL
LGSASGLRARFSGASEAPDGTRFVRLATGGQGPAVISFPPFAPVEQTLQF
VRLASFFRDRRDLSMVTVPGFLKGEPLAESVDVLIDVLAESAIHCAAGSP
FALLGYSSSGWLAHCVTARMEALGTPAQGLVLLDTYLPDGMSVALRQAMT
YEVNERRSRFTKLNFTTITALGTYRRMFRGWAPQPVSTPTLFIRPEECIP
GDPGLPPLTGEWRTHWPLPHTDATVPGDHCTIVAENADATAALVHDWLDA
L


Reference
    Title: Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster
    Palaniappan N, Kim BS, Sekiyama Y, Osada H, Reynolds KA
    Ref: Journal of Biological Chemistry, 278:35552, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer