Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9acto-q70kh4

Streptomyces thioluteus polyketide synthase type I

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Streptomyces thioluteus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces thioluteus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AJ575648
1 UniProt : Q70KH4
1 UniProt : Q70KH4
1 Interpro : Q70KH4
1 Prodom : Q70KH4
1 Pfam : Q70KH4
1 PIRSF : Q70KH4
1 SUPERFAM : Q70KH4
Sequence
Graphical view for this peptide sequence: 9acto-q70kh4
Colored MSA for Thioesterase (raw)
VDDETPLPELGFDSLTAVDLRNRLGADLGLRLPPSLVFQHPTVTALARHL
TGQWTPTETTPEEPAAEAPSTLAPLFARAGELGRGEAFQELVLRVAEFRP
TFDAPEERFRVPHVRLARGAADSAKLICFPTFAGGSGAHQYARLAAVSGG
ERDIWVLPAPGFTWQESLPASVETLARLQADSVEACADGGPVVLLGYSAG
GWIAQATATALQERGIAPAAVVLLDSHRPDSAMLPHLHAHIDGAREDVLW
TAGTGDDAYLTAMAHYAHLFHTWTPKETGTPTLLVRASDRPFDEAPTDWQ
PHWPLPHTAVDTAGTHFSIIREHSGPTLQAVHAWLDGLH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

VDDETPLPELGFDSLTAVDLRNRLGADLGLRLPPSLVFQHPTVTALARHL
TGQWTPTETTPEEPAAEAPSTLAPLFARAGELGRGEAFQELVLRVAEFRP
TFDAPEERFRVPHVRLARGAADSAKLICFPTFAGGSGAHQYARLAAVSGG
ERDIWVLPAPGFTWQESLPASVETLARLQADSVEACADGGPVVLLGYSAG
GWIAQATATALQERGIAPAAVVLLDSHRPDSAMLPHLHAHIDGAREDVLW
TAGTGDDAYLTAMAHYAHLFHTWTPKETGTPTLLVRASDRPFDEAPTDWQ
PHWPLPHTAVDTAGTHFSIIREHSGPTLQAVHAWLDGLH


Reference
    Title: Iteration as programmed event during polyketide assembly; molecular analysis of the aureothin biosynthesis gene cluster
    He J, Hertweck C
    Ref: Chemical Biology, 10:1225, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer