Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9apic-w7avu4

Plasmodium inui San Antonio 1. Uncharacterized protein

Relationship
Family|Maspardin-ACP33-SPG21_like
Block| X
Position in NCBI Life Tree|Plasmodium inui San Antonio 1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Alveolata: N E > Apicomplexa: N E > Aconoidasida: N E > Haemosporida: N E > Plasmodiidae: N E > Plasmodium: N E > Plasmodium (Plasmodium): N E > Plasmodium inui: N E > Plasmodium inui San Antonio 1: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KI965460
1 UniProt : W7AVU4
1 UniProt : W7AVU4
1 Interpro : W7AVU4
1 Pfam : W7AVU4
1 PIRSF : W7AVU4
1 SUPERFAM : W7AVU4
Sequence
Graphical view for this peptide sequence: 9apic-w7avu4
Colored MSA for Maspardin-ACP33-SPG21_like (raw)
MKSPEASMHEAYKSFCSQHPLKKLSMPKSDLVWSYYDINSRNENIVIFLH
GICGTAGCYFYQLDALANLGFRVISFQYPCYNYLKDWIKNMCNILEYLNI
KKAHFFASDLGGYLMQLYAKLYPSKVESLMLCNSYRRTDDFAAVAAFRNV
YGKLYSFLPHVLLKKIMLENYIYVNYVNIDLKEKNSLEFMSNEVDLISSA
DLGGRISLQLSSESVDRIHINDSSITILQTLNNTYADSLNEDMKNAYPYA
KHAILKSGGCFPYLSRHEEVNMYILVHLRNNCNAGFVKEQIISMSYMHQL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKSPEASMHEAYKSFCSQHPLKKLSMPKSDLVWSYYDINSRNENIVIFLH
GICGTAGCYFYQLDALANLGFRVISFQYPCYNYLKDWIKNMCNILEYLNI
KKAHFFASDLGGYLMQLYAKLYPSKVESLMLCNSYRRTDDFAAVAAFRNV
YGKLYSFLPHVLLKKIMLENYIYVNYVNIDLKEKNSLEFMSNEVDLISSA
DLGGRISLQLSSESVDRIHINDSSITILQTLNNTYADSLNEDMKNAYPYA
KHAILKSGGCFPYLSRHEEVNMYILVHLRNNCNAGFVKEQIISMSYMHQL



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer