Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9arch-q5nw20

uncultured archaeon hypothetical protein

Comment
only c-term Pfam A PAF-AH_p_II 255 620


Relationship
Family|PAF-Acetylhydrolase
Block| X
Position in NCBI Life Tree|uncultured archaeon
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > environmental samples: N E > uncultured archaeon: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CR626856
1 UniProt : Q5NW20
1 UniProt : Q5NW20
1 Interpro : Q5NW20
1 Prodom : Q5NW20
1 Pfam : Q5NW20
1 PIRSF : Q5NW20
1 SUPERFAM : Q5NW20
Sequence
Graphical view for this peptide sequence: 9arch-q5nw20
Colored MSA for PAF-Acetylhydrolase (raw)
GPRIVGVALYLASAAIMAAGAMSDKYKDRMPALLAALVVLATLASAVCIA
TVNTGISYPEPSGPYKVGKVAYDWVDENRTEIATGNSTYRELMVYVWYPA
DVPGNLTEAPAMDATTARGVRAGNVFSTAFLEGLSDHAYPAPPVAAGRSR
YPVLLMSHGDGSSPLLMAVTATDLASHGYVVAGISHTYNSRGTMFPDGRI
LESDFNYTLIQNDPYDFNLSYYENAKLWARHNAEVELREADDVSFVLDRM
EALNQSDDLFRGRIDTARAGTLGFSLGGAAAISSAERDDRIKAASDLDGA
LYHNVSIDKPTLLFLRGSRLSYDRPYDAVNQGLLTREQFEELKTIWDGYQ
MQVYTAPSTAYYVGIKGTEHGNFNDLGALGLPIDAGPVDGRHASRIINAY
LVAFFDRHLTGLDSPLLNGTQAYPEDVFRSRVNGTEVAG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GPRIVGVALYLASAAIMAAGAMSDKYKDRMPALLAALVVLATLASAVCIA
TVNTGISYPEPSGPYKVGKVAYDWVDENRTEIATGNSTYRELMVYVWYPA
DVPGNLTEAPAMDATTARGVRAGNVFSTAFLEGLSDHAYPAPPVAAGRSR
YPVLLMSHGDGSSPLLMAVTATDLASHGYVVAGISHTYNSRGTMFPDGRI
LESDFNYTLIQNDPYDFNLSYYENAKLWARHNAEVELREADDVSFVLDRM
EALNQSDDLFRGRIDTARAGTLGFSLGGAAAISSAERDDRIKAASDLDGA
LYHNVSIDKPTLLFLRGSRLSYDRPYDAVNQGLLTREQFEELKTIWDGYQ
MQVYTAPSTAYYVGIKGTEHGNFNDLGALGLPIDAGPVDGRHASRIINAY
LVAFFDRHLTGLDSPLLNGTQAYPEDVFRSRVNGTEVAG


Reference
    Title: The complete genomic sequence of Nocardia farcinica IFM 10152
    Ishikawa J, Yamashita A, Mikami Y, Hoshino Y, Kurita H, Hotta K, Shiba T, Hattori M
    Ref: Proc Natl Acad Sci U S A, 101:14925, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer