Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9asco-a0a1e4ss17

Suhomyces tanzawaensis NRRL Y-17324. Uncharacterized protein

Relationship
Family|Arb2_domain
Block| X
Position in NCBI Life Tree|Suhomyces tanzawaensis NRRL Y-17324
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Debaryomycetaceae: N E > Candida tanzawaensis clade: N E > [Candida] tanzawaensis: N E > Candida tanzawaensis NRRL Y-17324: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : KV453909, XP_020067314.1
1 UniProt : A0A1E4SS17
1 UniProt : A0A1E4SS17
1 Interpro : A0A1E4SS17
1 Prodom : A0A1E4SS17
1 Pfam : A0A1E4SS17
1 PIRSF : A0A1E4SS17
1 SUPERFAM : A0A1E4SS17
Sequence
Graphical view for this peptide sequence: 9asco-a0a1e4ss17
Colored MSA for Arb2_domain (raw)
IRSHQLSDLFNRHSFISIPIIPKFTANEKSNSFTNDLPPNLDDIIVASPN
IYDCSIVILTIHDPPDIWANVNPINGNIEANSSIVLQHPLTQIMAKIKQE
TENNDSTQSNDNIGYIDINIPSYQFPIPAGSSASGQSRSYNPTIFAQELL
LYVWDNYLAYFSQLKKLVFVGFGNAYQSIVHLYGKRPSQEIKELVKGTVA
FVGRSSLKSLVLAMDESMVDWYYQNSVVFTSCLNACWQGTNGTIGRGASV
KSEANGADDGSKRPRRKFGRVLRANADGLFDVINEKFDEGMDFILDSIED
YSSSDTNS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

IRSHQLSDLFNRHSFISIPIIPKFTANEKSNSFTNDLPPNLDDIIVASPN
IYDCSIVILTIHDPPDIWANVNPINGNIEANSSIVLQHPLTQIMAKIKQE
TENNDSTQSNDNIGYIDINIPSYQFPIPAGSSASGQSRSYNPTIFAQELL
LYVWDNYLAYFSQLKKLVFVGFGNAYQSIVHLYGKRPSQEIKELVKGTVA
FVGRSSLKSLVLAMDESMVDWYYQNSVVFTSCLNACWQGTNGTIGRGASV
KSEANGADDGSKRPRRKFGRVLRANADGLFDVINEKFDEGMDFILDSIED
YSSSDTNS



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer