Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9aves-a0a091iyw3

Egretta garzetta (little egret). Carboxylic ester hydrolase

Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Egretta garzetta
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Sauropsida: N E > Sauria: N E > Archelosauria: N E > Archosauria: N E > Dinosauria: N E > Saurischia: N E > Theropoda: N E > Coelurosauria: N E > Aves: N E > Neognathae: N E > Pelecaniformes: N E > Ardeidae: N E > Egretta: N E > Egretta garzetta: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KK501247
1 UniProt : A0A091IYW3
1 UniProt : A0A091IYW3
1 Interpro : A0A091IYW3
1 Prodom : A0A091IYW3
1 Pfam : A0A091IYW3
1 PIRSF : A0A091IYW3
1 SUPERFAM : A0A091IYW3
Sequence
Graphical view for this peptide sequence: 9aves-a0a091iyw3
Colored MSA for Carb_B_Chordata (raw)
QPEVVTKYGRVRGYQFKVDAAERSVNVFLGLPFAKPPVGPLRFSEPQPPE
PWKGVRDATSYPPMCLQDKVQGQVFSDIITNRKEKVLLQVSEDCLYLNVY
TPVSTEEQEKLPVFVWIHGGGLVFGAASSYDGSALAAFDNVVVVTIQYRL
GIVGYFSTGDKHARGNWGYLDQVAALQWIQENIIHFGGDPGSVTIAGESA
GGISVSALVLSPLAKGLFHKAISESGTAVRVLFTDQPEEEAQRIAAASGC
EKSSSAAIVECLREKTEEDIVQITLKMSSLFISASADGVFFPKSPRQLLS
EKMINAVPYIIGVNNCEFGWVLPMTMKFPAYTDGLDEDVARQILQSSLAL
SLKGVTSDVVDQVYNEYIGNAENRAQVRDGLLDAIGDPLFVLSAIEVARY
HRDAGNPVYFYEFQHRPSSATGVVPEFVKADHTDEIAFVFGKPFLAGHAT
EEENKLSRTVMRYWTNFARNGNPNGEGLVHWPQYDLDERYLEIDLMQKEA
KKLKERKMEFWTRLTQQMMNERREHTDL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

QPEVVTKYGRVRGYQFKVDAAERSVNVFLGLPFAKPPVGPLRFSEPQPPE
PWKGVRDATSYPPMCLQDKVQGQVFSDIITNRKEKVLLQVSEDCLYLNVY
TPVSTEEQEKLPVFVWIHGGGLVFGAASSYDGSALAAFDNVVVVTIQYRL
GIVGYFSTGDKHARGNWGYLDQVAALQWIQENIIHFGGDPGSVTIAGESA
GGISVSALVLSPLAKGLFHKAISESGTAVRVLFTDQPEEEAQRIAAASGC
EKSSSAAIVECLREKTEEDIVQITLKMSSLFISASADGVFFPKSPRQLLS
EKMINAVPYIIGVNNCEFGWVLPMTMKFPAYTDGLDEDVARQILQSSLAL
SLKGVTSDVVDQVYNEYIGNAENRAQVRDGLLDAIGDPLFVLSAIEVARY
HRDAGNPVYFYEFQHRPSSATGVVPEFVKADHTDEIAFVFGKPFLAGHAT
EEENKLSRTVMRYWTNFARNGNPNGEGLVHWPQYDLDERYLEIDLMQKEA
KKLKERKMEFWTRLTQQMMNERREHTDL



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer