Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-MChE2

Uncultured bacterium MGS-MChE2,alpha/beta hydrolase enzyme from sediment sample of lagoon of Mar Chica, Morocco

Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
5JD6: Crystal structure of MGS-MChE2, an enzyme from the metagenome of sediments from the lagoon of Mar Chica, Morocco
No kinetic





No Substrate
No inhibitor
1 Genbank : WP_072553907
1 Structure : 5JD6
Sequence
Graphical view for this peptide sequence: 9bact-MChE2
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MKDHLKQEGKFTYLEKGEGTPIVILHGLMGGLSNFDGVIDYFPEKGYKVL
IPELPLYSMSLLKTSVGTFARYLKEFVDFKGYENVILLGNSLGGHIALLA
TKMFPEIVQALVITGSSGLYENAMGESYPRRGDYEFIKKKAEAVFYDPEV
ATKEIVDEVYETVSDRNKLVKTLAIAKSAIRHNMAKDLPKMKTPTCIIWG
KNDNVTPPEVAEDFKRLLPDADLYWIDKCGHAAMMEHPEEFNQLLHEWFK
ERDF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKDHLKQEGKFTYLEKGEGTPIVILHGLMGGLSNFDGVIDYFPEKGYKVL
IPELPLYSMSLLKTSVGTFARYLKEFVDFKGYENVILLGNSLGGHIALLA
TKMFPEIVQALVITGSSGLYENAMGESYPRRGDYEFIKKKAEAVFYDPEV
ATKEIVDEVYETVSDRNKLVKTLAIAKSAIRHNMAKDLPKMKTPTCIIWG
KNDNVTPPEVAEDFKRLLPDADLYWIDKCGHAAMMEHPEEFNQLLHEWFK
ERDF


Reference
    Title: Biogenic nanopalladium based remediation of chlorinated hydrocarbons in marine environments
    Hosseinkhani B, Hennebel T, Van Nevel S, Verschuere S, Yakimov MM, Cappello S, Blaghen M, Boon N
    Ref: Environ Sci Technol, 48:550, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer