Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-a0a0f9xu71

candidate division TM6 bacterium GW2011_GWF2_28_16. Uncharacterized protein

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|candidate division TM6 bacterium GW2011_GWF2_28_16
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > unclassified Bacteria: N E > Bacteria candidate phyla: N E > Candidatus Dependentiae: N E > unclassified Candidatus Dependentiae: N E > candidate division TM6 bacterium GW2011_GWF2_28_16: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : LBNX01000005
1 UniProt : A0A0F9XU71
1 UniProt : A0A0F9XU71
1 Interpro : A0A0F9XU71
1 Pfam : A0A0F9XU71
1 PIRSF : A0A0F9XU71
1 SUPERFAM : A0A0F9XU71
Sequence
Graphical view for this peptide sequence: 9bact-a0a0f9xu71
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MKEKVGIFFLSLFLFNILNSTVIVTHGAWGDEMEWYRPGGYFHEALKVPA
QTMGQTIQAFTWKQSLGGITHRERLNAAKDLAKLIVDLNNKGEKEIILIG
HSYGGHVIKAASQLLAVALDFQTAQVPIISQDKNNLVSDKIANTQEWDQK
YYEQVCTEVKEYNKLHPVSKSLNSDCLMDRVYTLGTPNDIPDYEANMKVV
GCLFNFYSKGDLVQDLVGDHLLPEPKNDRAANLEVKIKGTGWFGLTNKPG
HMKMHSEIIAKWILYIPFYLMTDKKTGFDKFNFERNGLVKFAENKTPTYS
YTKSTMIDYLSWDYIKELLGIKV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKEKVGIFFLSLFLFNILNSTVIVTHGAWGDEMEWYRPGGYFHEALKVPA
QTMGQTIQAFTWKQSLGGITHRERLNAAKDLAKLIVDLNNKGEKEIILIG
HSYGGHVIKAASQLLAVALDFQTAQVPIISQDKNNLVSDKIANTQEWDQK
YYEQVCTEVKEYNKLHPVSKSLNSDCLMDRVYTLGTPNDIPDYEANMKVV
GCLFNFYSKGDLVQDLVGDHLLPEPKNDRAANLEVKIKGTGWFGLTNKPG
HMKMHSEIIAKWILYIPFYLMTDKKTGFDKFNFERNGLVKFAENKTPTYS
YTKSTMIDYLSWDYIKELLGIKV


Reference
    Title: Unusual biology across a group comprising more than 15% of domain Bacteria
    Brown CT, Hug LA, Thomas BC, Sharon I, Castelle CJ, Singh A, Wilkins MJ, Wrighton KC, Williams KH, Banfield JF
    Ref: Nature, 523:208, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer