Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-c0a864

Geminisphaera colitermitum TAV2 Acetyl esterase (Deacetylase)-like protein

Comment
only c-term Pfam A AXE1 134 359 and 352 436


Relationship
Family|Acetyl-esterase_deacetylase
Block| X
Position in NCBI Life Tree|Geminisphaera colitermitum TAV2
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > PVC group: N E > Verrucomicrobia: N E > Opitutae: N E > Opitutales: N E > Opitutaceae: N E > Didymococcus: N E > Didymococcus colitermitum: N E > Didymococcus colitermitum TAV2: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : WP_052361607
Sequence
Graphical view for this peptide sequence: 9bact-c0a864
Colored MSA for Acetyl-esterase_deacetylase (raw)
SIPEPADFDAWWAKQKAKLAKIPLTVLEQKPLPETHPNVETFDIKVACTG
PILAGDSAPKPVSGYFSKTKNAAPKSAAAFVKFHGYGKRSAIRRDEDAND
PANPKLVLDINAHGIENGQPAEFYANLSETTLKNYAFNKQENATPETAYF
YGIALRALRALEFIKSQPEWDGKNLTVTGGSQGGFQALLVAGLDPDVTRC
TAGKPWVCDLGGITINRLKGWRPDYTRALDYFDPVNHAKRIRADTYITSG
LGDYVCPPSGVTVLYNNIPDTTSKRIEYIQGATHRRYPSSLNPVKFVVKN
K
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

SIPEPADFDAWWAKQKAKLAKIPLTVLEQKPLPETHPNVETFDIKVACTG
PILAGDSAPKPVSGYFSKTKNAAPKSAAAFVKFHGYGKRSAIRRDEDAND
PANPKLVLDINAHGIENGQPAEFYANLSETTLKNYAFNKQENATPETAYF
YGIALRALRALEFIKSQPEWDGKNLTVTGGSQGGFQALLVAGLDPDVTRC
TAGKPWVCDLGGITINRLKGWRPDYTRALDYFDPVNHAKRIRADTYITSG
LGDYVCPPSGVTVLYNNIPDTTSKRIEYIQGATHRRYPSSLNPVKFVVKN
K



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer