Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-f8x1n1.1

Dysgonomonas mossii DSM 22836 carboxy-terminal carbohydrate esterase family 1 (CE1) first CE domain of the multidomain esterase DmCE1B

Relationship
Family|A85-Feruloyl-Esterase
Block| X
Position in NCBI Life Tree|Dysgonomonas mossii DSM 22836
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Bacteroidetes: N E > Bacteroidia: N E > Bacteroidales: N E > Dysgonamonadaceae: N E > Dysgonomonas: N E > Dysgonomonas mossii: N E > Dysgonomonas mossii DSM 22836: N E


Molecular evidence
Database
No mutation
2 structures: 7B5V, 7B6B
No kinetic





No Substrate
No inhibitor
2 Genbank : EGK06015, WP_006843649
1 UniProt : F8X1N1
2 Structure : 7B6B, 7B5V
1 UniProt : F8X1N1
1 Interpro : F8X1N1
1 Prodom : F8X1N1
1 Pfam : F8X1N1
1 PIRSF : F8X1N1
1 SUPERFAM : F8X1N1
Sequence
Graphical view for this peptide sequence: 9bact-f8x1n1.1
Colored MSA for A85-Feruloyl-Esterase (raw)
MKKFFFLHLFIWALTVGAISQNYKSVPNGYDIPRTGISHGQIDTVTYYSK
TVDTNRKALVYTPPGYSKNKQYPVLYLLHGIGGDEKEWFSHGQPQVILDN
LYADKKIVPMIVVLPNGRAMKDDRAIGNIMEAPKVEAFATFEKDLLNDLI
PFIQKTYPVLKNQENRALAGLSMGGGQSLNFGLGNLDIFAWVGGFSSAPN
TKTPEVLVPNPDDAKKKLKLLWISCGDKDGLLSFSKRTHDYLAKNQVPHV
YQVIPNGYHDFNIWKQNLYMFSQLLFKPVTADLIEQYSYIPEEAEVGIS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKFFFLHLFIWALTVGAISQNYKSVPNGYDIPRTGISHGQIDTVTYYSK
TVDTNRKALVYTPPGYSKNKQYPVLYLLHGIGGDEKEWFSHGQPQVILDN
LYADKKIVPMIVVLPNGRAMKDDRAIGNIMEAPKVEAFATFEKDLLNDLI
PFIQKTYPVLKNQENRALAGLSMGGGQSLNFGLGNLDIFAWVGGFSSAPN
TKTPEVLVPNPDDAKKKLKLLWISCGDKDGLLSFSKRTHDYLAKNQVPHV
YQVIPNGYHDFNIWKQNLYMFSQLLFKPVTADLIEQYSYIPEEAEVGIS


References
    Title: A polysaccharide utilization locus from the gut bacterium Dysgonomonas mossii encodes functionally distinct carbohydrate esterases
    Kmezik C, Mazurkewich S, Meents T, McKee LS, Idstrom A, Armeni M, Savolainen O, Branden G, Larsbrink J
    Ref: Journal of Biological Chemistry, :100500, 2021 : PubMed

            

    Title: Multimodular fused acetyl-feruloyl esterases from soil and gut Bacteroidetes improve xylanase depolymerization of recalcitrant biomass
    Kmezik C, Bonzom C, Olsson L, Mazurkewich S, Larsbrink J
    Ref: Biotechnol Biofuels, 13:60, 2020 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer