Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-q1q3k9

Candidatus Kuenenia stuttgartiensis Similar to 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase (EC 3.7.1.9)

Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Candidatus Kuenenia stuttgartiensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > PVC group: N E > Planctomycetes: N E > Planctomycetia: N E > Candidatus Brocadiales: N E > Candidatus Brocadiaceae: N E > Candidatus Kuenenia: N E > Candidatus Kuenenia stuttgartiensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CT573071
1 UniProt : Q1Q3K9
1 UniProt : Q1Q3K9
1 Interpro : Q1Q3K9
1 Prodom : Q1Q3K9
1 Pfam : Q1Q3K9
1 PIRSF : Q1Q3K9
1 SUPERFAM : Q1Q3K9
Sequence
Graphical view for this peptide sequence: 9bact-q1q3k9
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MLRCIFYMTMRENWIKVGSATIHYFVAGDGDRNVVLLHGGGTNSAMLSWK
YVIPHLSQKYKVFAPDWPSYGQSSAFTGNYTSDLLIDFLSRLMDAWQLQK
ASLVGLSMGGAATLGYTLIFPERVGSIVLAGSYGLQHKAPYHTLSYLLLH
MPFFSKIICECIRGSHFVIRSCLQKTFCDHRLISDELVHEIHTVAQRSCT
EKAFFSWLRNEVLWNGMQTCYAQRFHELQTRTLLLHGECDSLVPLYYAQQ
AASLIKNARLHVINKCGHWLTRERPEEFNRVVSAFL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLRCIFYMTMRENWIKVGSATIHYFVAGDGDRNVVLLHGGGTNSAMLSWK
YVIPHLSQKYKVFAPDWPSYGQSSAFTGNYTSDLLIDFLSRLMDAWQLQK
ASLVGLSMGGAATLGYTLIFPERVGSIVLAGSYGLQHKAPYHTLSYLLLH
MPFFSKIICECIRGSHFVIRSCLQKTFCDHRLISDELVHEIHTVAQRSCT
EKAFFSWLRNEVLWNGMQTCYAQRFHELQTRTLLLHGECDSLVPLYYAQQ
AASLIKNARLHVINKCGHWLTRERPEEFNRVVSAFL


Reference
    Title: Deciphering the evolution and metabolism of an anammox bacterium from a community genome
    Strous M, Pelletier E, Mangenot S, Rattei T, Lehner A, Taylor MW, Horn M, Daims H, Bartol-Mavel D and Le Paslier D <27 more author(s)>
    Ref: Nature, 440:790, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer