Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-q4tzq3

uncultured bacterium esterase Est25

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
4 structures (e.g. : 4J7A, 5IQ0, 5IQ2... more)
No kinetic





1 substrate:
Ketoprofen-Ethyl-Ester
No inhibitor
1 Genbank : DQ025532
1 UniProt : Q4TZQ3
>3 Structure links 1 more: 5IQ0, 5IQ2, 5IQ3
1 UniProt : Q4TZQ3
1 Interpro : Q4TZQ3
1 Prodom : Q4TZQ3
1 Pfam : Q4TZQ3
1 PIRSF : Q4TZQ3
1 SUPERFAM : Q4TZQ3
Sequence
Graphical view for this peptide sequence: 9bact-q4tzq3
Colored MSA for Hormone-sensitive_lipase_like (raw)
MSNATLNQLPGRLGDPSMSLGTDPRTDPRLAAALTQLGLADQAAEPPVNA
NSEVADCIAYSTAAEQAWQTLGAMLGSQGEPSNPVDVREETIKGRGGNEI
KLYIHSPTGHTSDSDPLPCVVHTHGGGMVILTAADANYSRWRSELAATGL
VVVGVEFRNAAGALGNHPFPAGLHDCADAAKWVASNREALGISTLIMSGE
SGGGNLSLATTMLAKKEGWLEEIAGVYAQCPYISGLYASKPEELPSLLEN
DAYFLDMKTMGAMVKPYDPTGENASNPLAWPYHASLEDLAGLPPHVISVN
ELDPLRDEGLAHYRKLLKAGVSTVGRTVHGTCHAADCSFVDVIPDVYFAT
VRDISAFAYSRA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSNATLNQLPGRLGDPSMSLGTDPRTDPRLAAALTQLGLADQAAEPPVNA
NSEVADCIAYSTAAEQAWQTLGAMLGSQGEPSNPVDVREETIKGRGGNEI
KLYIHSPTGHTSDSDPLPCVVHTHGGGMVILTAADANYSRWRSELAATGL
VVVGVEFRNAAGALGNHPFPAGLHDCADAAKWVASNREALGISTLIMSGE
SGGGNLSLATTMLAKKEGWLEEIAGVYAQCPYISGLYASKPEELPSLLEN
DAYFLDMKTMGAMVKPYDPTGENASNPLAWPYHASLEDLAGLPPHVISVN
ELDPLRDEGLAHYRKLLKAGVSTVGRTVHGTCHAADCSFVDVIPDVYFAT
VRDISAFAYSRA


References
1 more
    Title: Crystal structure and characterization of esterase Est25 mutants reveal improved enantioselectivity toward (S)-ketoprofen ethyl ester
    Kim J, Seok SH, Hong E, Yoo TH, Seo MD, Ryu Y
    Ref: Applied Microbiology & Biotechnology, 101:2333, 2017 : PubMed

            

    Title: Purification, crystallization and preliminary crystallographic analysis of Est25: a ketoprofen-specific hormone-sensitive lipase
    Kim S, Joo S, Yoon HC, Ryu Y, Kim KK, Kim TD
    Ref: Acta Crystallographica Sect F Struct Biol Cryst Commun, 63:579, 2007 : PubMed

            

    Title: Screening and characterization of a novel esterase from a metagenomic library
    Kim YJ, Choi GS, Kim SB, Yoon GS, Kim YS, Ryu YW
    Ref: Protein Expr Purif, 45:315, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer