Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-q5i686

symbiont bacterium of Paederus fuscipes pedq

Relationship
Family|ABHD6-Lip
Block| X
Position in NCBI Life Tree|symbiont bacterium of Paederus fuscipes
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > unclassified Bacteria: N E > unclassified Bacteria (miscellaneous): N E > symbiont bacterium of Paederus fuscipes: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AY850690
1 UniProt : Q5I686
1 UniProt : Q5I686
1 Interpro : Q5I686
1 Prodom : Q5I686
1 Pfam : Q5I686
1 PIRSF : Q5I686
1 SUPERFAM : Q5I686
Sequence
Graphical view for this peptide sequence: 9bact-q5i686
Colored MSA for ABHD6-Lip (raw)
MELLVGSIGLVFLTILIVLLCIAVAFYLIAPGLLLDSFLALGRWHAGLKR
RESTLDMVNWVWLDSGGEGDVIVLIHGFAAHKYGWLQVASRLRGRGYRLI
IPDLPGFGENQVSADISYSVLEQAQRLQTFLASLGINRFHAVGHSMGGYV
AGACAFIDSDMLLSLYLVAPAGITVEGEPIDLSEKGKKNNLFIIETVEQF
QEVMAIAMANPPKLPRRIVESMVARELTMRKLREKQNEVWDSPSLQRLLS
NCSIPLRMLWGERDRMLSVDRAALIVEAVPMASIRYLPDIAHVIPQEAPS
VMVRDYLISLLLSH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MELLVGSIGLVFLTILIVLLCIAVAFYLIAPGLLLDSFLALGRWHAGLKR
RESTLDMVNWVWLDSGGEGDVIVLIHGFAAHKYGWLQVASRLRGRGYRLI
IPDLPGFGENQVSADISYSVLEQAQRLQTFLASLGINRFHAVGHSMGGYV
AGACAFIDSDMLLSLYLVAPAGITVEGEPIDLSEKGKKNNLFIIETVEQF
QEVMAIAMANPPKLPRRIVESMVARELTMRKLREKQNEVWDSPSLQRLLS
NCSIPLRMLWGERDRMLSVDRAALIVEAVPMASIRYLPDIAHVIPQEAPS
VMVRDYLISLLLSH


Reference
    Title: Antitumor polyketide biosynthesis by an uncultivated bacterial symbiont of the marine sponge Theonella swinhoei
    Piel J, Hui D, Wen G, Butzke D, Platzer M, Fusetani N, Matsunaga S
    Ref: Proc Natl Acad Sci U S A, 101:16222, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer