Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-q6wlc7

uncultured bacterium csw020

Relationship
Family|Prolyl_oligopeptidase_S9
Block| X
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AY280635
1 UniProt : Q6WLC7
1 UniProt : Q6WLC7
1 Interpro : Q6WLC7
1 Pfam : Q6WLC7
1 PIRSF : Q6WLC7
1 SUPERFAM : Q6WLC7
Sequence
Graphical view for this peptide sequence: 9bact-q6wlc7
Colored MSA for Prolyl_oligopeptidase_S9 (raw)
MRADSKGDEMRISARWSMVCHALLLASSLCLMATQARAQAAPEPLKPPST
QDFSQLPMVMDLSLSPDGQHVAGLLNIDDKTLLFTRGVHDQKLVYLSSTD
NKAFKIAWLQWASNDRLVFGLRFAASRDFIGTVETRLMSVKRDGTELINL
VSTSPFSSNRFQSQFQDRVIDWLPGDGHHILMELNEGYSYSPAVFKVNLD
TGMRQMVHTPKRHVRNWVTDQTHRVRLGVLHDEAKREVQVCDPDGKNWRT
LWRYEVFSKDAIYPLGFGLNPQELYISANHEGRLAVFKVNLASPDLQHEL
VLSHAELDVSGQLIRSQATGQIIGIHTGIQDEQRPDFWDPSLRLLARAID
KALPERFNSLIELSRDEQHYLIYSVGNGKPGEYYLGNRKTGDLALVAETH
PELPQASLVGKQPVQIKARDGLVLTAYLTRPAKSPGALPLVLLPHGGPDS
RDNSRFDVWTEFLASRGYAVLQVNFRGSAGYGHDMMVAGLQRWGLEMQDD
LSDAVQWAIAQGVADPKRVGIVGFSYGGYAALMGSVKTPDLFRCAVSVAG
VTDLIDLWYHQNQYIGGAAIADKQIGNAWNDRKRLTETSPALQAERIKVP
VLLIHGTDDRTVPFEQGEAMDKALRRAKVPHRFVELEGGDHQLSRNSHRL
MVFKELEDFLAQNMGAPKVLAQQQQP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRADSKGDEMRISARWSMVCHALLLASSLCLMATQARAQAAPEPLKPPST
QDFSQLPMVMDLSLSPDGQHVAGLLNIDDKTLLFTRGVHDQKLVYLSSTD
NKAFKIAWLQWASNDRLVFGLRFAASRDFIGTVETRLMSVKRDGTELINL
VSTSPFSSNRFQSQFQDRVIDWLPGDGHHILMELNEGYSYSPAVFKVNLD
TGMRQMVHTPKRHVRNWVTDQTHRVRLGVLHDEAKREVQVCDPDGKNWRT
LWRYEVFSKDAIYPLGFGLNPQELYISANHEGRLAVFKVNLASPDLQHEL
VLSHAELDVSGQLIRSQATGQIIGIHTGIQDEQRPDFWDPSLRLLARAID
KALPERFNSLIELSRDEQHYLIYSVGNGKPGEYYLGNRKTGDLALVAETH
PELPQASLVGKQPVQIKARDGLVLTAYLTRPAKSPGALPLVLLPHGGPDS
RDNSRFDVWTEFLASRGYAVLQVNFRGSAGYGHDMMVAGLQRWGLEMQDD
LSDAVQWAIAQGVADPKRVGIVGFSYGGYAALMGSVKTPDLFRCAVSVAG
VTDLIDLWYHQNQYIGGAAIADKQIGNAWNDRKRLTETSPALQAERIKVP
VLLIHGTDDRTVPFEQGEAMDKALRRAKVPHRFVELEGGDHQLSRNSHRL
MVFKELEDFLAQNMGAPKVLAQQQQP


Reference
    Title: Metagenome survey of biofilms in drinking-water networks
    Schmeisser C, Stockigt C, Raasch C, Wingender J, Timmis KN, Wenderoth DF, Flemming HC, Liesegang H, Schmitz RA and Streit WR <1 more author(s)>
    Ref: Applied Environmental Microbiology, 69:7298, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer