Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9basi-a0a221se81

Glaciozyma antarctica. Dienelactone hydrolase

Relationship
Family|Dienelactone_hydrolase
Block| X
Position in NCBI Life Tree|Glaciozyma antarctica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Pucciniomycotina: N E > Microbotryomycetes: N E > Kriegeriales: N E > Camptobasidiaceae: N E > Glaciozyma: N E > Glaciozyma antarctica: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
Dienelactone
No inhibitor
2 Genbank : KX907622, ASN74467
1 UniProt : A0A221SE81
1 UniProt : A0A221SE81
1 Interpro : A0A221SE81
1 Prodom : A0A221SE81
1 Pfam : A0A221SE81
1 PIRSF : A0A221SE81
1 SUPERFAM : A0A221SE81
Sequence
Graphical view for this peptide sequence: 9basi-a0a221se81
Colored MSA for Dienelactone_hydrolase (raw)
MSAPTLGSCCIRGVSHEGTPKGTVTSFNGTPTYVTLPSGDYDKTKALLFC
PDVFGLELQNAKLLADDFAANGYATYLPDYLAGDALHKDALNDGTFDLMG
WLGKHPQSVTRPYLDALIAGLKEQGVKEFAATGYCYGGRYVFDLALDHII
KVAIVSHPSLLSVPEDLEKLKSVGTIPFLWNTCETDFAFGPEKQEIADKV
FADDKNYKRTFAPGCDHGFAVRGDLSVPAIKAGKEVAFEESVKWLQKHF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSAPTLGSCCIRGVSHEGTPKGTVTSFNGTPTYVTLPSGDYDKTKALLFC
PDVFGLELQNAKLLADDFAANGYATYLPDYLAGDALHKDALNDGTFDLMG
WLGKHPQSVTRPYLDALIAGLKEQGVKEFAATGYCYGGRYVFDLALDHII
KVAIVSHPSLLSVPEDLEKLKSVGTIPFLWNTCETDFAFGPEKQEIADKV
FADDKNYKRTFAPGCDHGFAVRGDLSVPAIKAGKEVAFEESVKWLQKHF


Reference
    Title: Biochemical and structural characterization of a novel cold-active esterase-like protein from the psychrophilic yeast Glaciozyma antarctica
    Hashim NHF, Mahadi NM, Illias RM, Feroz SR, Abu Bakar FD, Murad AMA
    Ref: Extremophiles, 22:607, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer