Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bila-a0a2a2jvw9

Diploscapter pachys, Carboxylic ester hydrolase

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Diploscapter pachys
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Nematoda: N E > Chromadorea: N E > Rhabditida: N E > Rhabditoidea: N E > Diploscapteridae: N E > Diploscapter: N E > Diploscapter pachys: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 UniProt : A0A2A2J339, A0A2A2JVW9
2 Interpro : A0A2A2J339, A0A2A2JVW9
2 Pfam : A0A2A2J339, A0A2A2JVW9
2 PIRSF : A0A2A2J339, A0A2A2JVW9
2 SUPERFAM : A0A2A2J339, A0A2A2JVW9
Sequence
Graphical view for this peptide sequence: 9bila-a0a2a2jvw9
Colored MSA for ACHE (raw)
MVLRYLALKSNLHTAKQSLNSSSADTYFGDFYGSQMWNANTPLSEDCLYL
NVFVPGTFDPTRKLAVMVWVYGGGFWSGTASLDVYDGRILPTDENIILIS
MNYRVSIFGFLYLGRPEAPGNMGLWDQLLALKWVHKNIDLFGGDPTRITL
FGESAGAASVNMHMLSARSTPYFNRAIIQSGSVTAPWAIESRQTALMRTL
IMYKEMGCGNMTETAPDYDLILRCLLHADADLLREKEYAPVREFADFPWV
PIIDGDFLVESPENSLRHGNFKKTQLLAGSNADEGIYFIVYQLTKIFPVN
EFFTDKDFIKDKQTWLTSALDLLPEQMRSSQLILQAIFHEYEPVNYPVKP
REWLDSLDKMLGDYHFTCGVNEMALAHSKHGGDTYYYMFTHRATAQTWPS
WMGVIHGYEINFVFGEPFNRKFKYTDEERELSSRFMRYWANFARTGDPNR
NEDGSYTQDVFPKYAPGTMEYMNMTVESSYSKDGRRTGNGPRRKYCGFWK
GYLPSLMAAVADIGEPYLMWKEQMNKWQNEYIQDWQFHFEQYKKYQPYLQ
SDREQCSGS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVLRYLALKSNLHTAKQSLNSSSADTYFGDFYGSQMWNANTPLSEDCLYL
NVFVPGTFDPTRKLAVMVWVYGGGFWSGTASLDVYDGRILPTDENIILIS
MNYRVSIFGFLYLGRPEAPGNMGLWDQLLALKWVHKNIDLFGGDPTRITL
FGESAGAASVNMHMLSARSTPYFNRAIIQSGSVTAPWAIESRQTALMRTL
IMYKEMGCGNMTETAPDYDLILRCLLHADADLLREKEYAPVREFADFPWV
PIIDGDFLVESPENSLRHGNFKKTQLLAGSNADEGIYFIVYQLTKIFPVN
EFFTDKDFIKDKQTWLTSALDLLPEQMRSSQLILQAIFHEYEPVNYPVKP
REWLDSLDKMLGDYHFTCGVNEMALAHSKHGGDTYYYMFTHRATAQTWPS
WMGVIHGYEINFVFGEPFNRKFKYTDEERELSSRFMRYWANFARTGDPNR
NEDGSYTQDVFPKYAPGTMEYMNMTVESSYSKDGRRTGNGPRRKYCGFWK
GYLPSLMAAVADIGEPYLMWKEQMNKWQNEYIQDWQFHFEQYKKYQPYLQ
SDREQCSGS


Reference
    Title: Genome Architecture and Evolution of a Unichromosomal Asexual Nematode
    Fradin H, Kiontke K, Zegar C, Gutwein M, Lucas J, Kovtun M, Corcoran DL, Baugh LR, Fitch DHA and Gunsalus KC <1 more author(s)>
    Ref: Current Biology, 27:2928, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer