Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bras-a0a565btv1

Arabis nemorensis. Uncharacterized protein

Relationship
Family|Plant_lipase_EDS1-like
Block| L
Position in NCBI Life Tree|Arabis nemorensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Arabideae: N E > Arabis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CABITT030000005
1 UniProt : A0A565BTV1
1 UniProt : A0A565BTV1
1 Interpro : A0A565BTV1
1 Prodom : A0A565BTV1
1 Pfam : A0A565BTV1
1 PIRSF : A0A565BTV1
1 SUPERFAM : A0A565BTV1
Sequence
Graphical view for this peptide sequence: 9bras-a0a565btv1
Colored MSA for Plant_lipase_EDS1-like (raw)
MAFQAPTGINGDLIKSSWTASEKAYGAEHYHKEETRDSVIFAFRPSFLDS
DWFARANESAFGEMRMDRIKNPCMRSIGNNVDATVNQAFLQNLEAIITNS
RTSFAASVETASKSGKQIVFTGHSSGGATAILATVWYLQXHFITNPNGLP
EPRCVTFGAPLLGDYVFKHALGREKWSRFFTNFVTRFDIVPRIMLAQKAS
VEQTLPRVLSQLSRTRDSIQENDPVIAEFYKAVMKDTATVAYRAVCELIG
NGEAFLETLSSFLELSPYRPVGTFVFSTGTRLVSVHNSDAILQILFYASQ
SSNEQEWSQIPYQSMRDHYSYGELVQSMENSHHLLLDGENLTALNDLTLS
ARAGQCVRAAFEAEKQRVKNQDDMDAKWPKIDKELTWIEDTYKPMCQTHK
NGYYDSFKASSEEIDFNANVKRAELAGIYDEVLGLVKKGQLPDEFEGRIQ
WIELATRYRRLIEPLDIANYHRHLKNEDTGPYMVKGRPNRYIYAERGYKH
GLLKSKGLIAETEFWSKVDALDFGSPETMREVLKISGSQSGSCFWAEVEE
LKGKPYAEAELRIKTLEGLLGGWIQEKEVCDQQIFLEDSTYRKWWNSLPD
NHKRQSPVRNLIMSVTRPT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAFQAPTGINGDLIKSSWTASEKAYGAEHYHKEETRDSVIFAFRPSFLDS
DWFARANESAFGEMRMDRIKNPCMRSIGNNVDATVNQAFLQNLEAIITNS
RTSFAASVETASKSGKQIVFTGHSSGGATAILATVWYLQXHFITNPNGLP
EPRCVTFGAPLLGDYVFKHALGREKWSRFFTNFVTRFDIVPRIMLAQKAS
VEQTLPRVLSQLSRTRDSIQENDPVIAEFYKAVMKDTATVAYRAVCELIG
NGEAFLETLSSFLELSPYRPVGTFVFSTGTRLVSVHNSDAILQILFYASQ
SSNEQEWSQIPYQSMRDHYSYGELVQSMENSHHLLLDGENLTALNDLTLS
ARAGQCVRAAFEAEKQRVKNQDDMDAKWPKIDKELTWIEDTYKPMCQTHK
NGYYDSFKASSEEIDFNANVKRAELAGIYDEVLGLVKKGQLPDEFEGRIQ
WIELATRYRRLIEPLDIANYHRHLKNEDTGPYMVKGRPNRYIYAERGYKH
GLLKSKGLIAETEFWSKVDALDFGSPETMREVLKISGSQSGSCFWAEVEE
LKGKPYAEAELRIKTLEGLLGGWIQEKEVCDQQIFLEDSTYRKWWNSLPD
NHKRQSPVRNLIMSVTRPT



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer