Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-h5wr76

Burkholderiales bacterium JOSHI_001 Esterase/lipase

Comment
Other strains: Burkholderiales bacterium


Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Burkholderiales bacterium JOSHI_001
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > unclassified Burkholderiales: N E > unclassified Burkholderiales (miscellaneous): N E > Burkholderiales bacterium JOSHI_001: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : WP_009550925
1 UniProt : H5WR76
1 Interpro : H5WR76
1 Prodom : H5WR76
1 Pfam : H5WR76
1 PIRSF : H5WR76
1 SUPERFAM : H5WR76
Sequence
Graphical view for this peptide sequence: 9burk-h5wr76
Colored MSA for Hormone-sensitive_lipase_like (raw)
MLDPQARALIDLMVERGVPPTHTLAPAQARQFYRERRSFTQADPRPLPEV
RDQSAPGPQGPIALRLYRPDSAPATGAPALVYFHGGGWVIGDLDTHDVLC
RELAHQSGRVVLAVDYRLGPEHRFPGAVDDCLAATRWVLAQAAALGLDAQ
RVAVGGDSAGGNLSAVVGLALRDAGTAPALQGQLLIYPATDMRAVAPSHS
HNGQGYLLTRDTIAYFRGLYIEQPEQWADWRASPLLHPDLSKLPRALVLT
AGFDPLRDEGRQYADALSGAGTPCQYVCFERQIHGFITMTRVLDEARSAV
ALCAQWLRALG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLDPQARALIDLMVERGVPPTHTLAPAQARQFYRERRSFTQADPRPLPEV
RDQSAPGPQGPIALRLYRPDSAPATGAPALVYFHGGGWVIGDLDTHDVLC
RELAHQSGRVVLAVDYRLGPEHRFPGAVDDCLAATRWVLAQAAALGLDAQ
RVAVGGDSAGGNLSAVVGLALRDAGTAPALQGQLLIYPATDMRAVAPSHS
HNGQGYLLTRDTIAYFRGLYIEQPEQWADWRASPLLHPDLSKLPRALVLT
AGFDPLRDEGRQYADALSGAGTPCQYVCFERQIHGFITMTRVLDEARSAV
ALCAQWLRALG



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer