Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-q58lx7

Delftia tsuruhatensis, Diaphorobacter sp. PCA039, 2-hydroxymuconic semialdehyde hydrolase

Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Delftia tsuruhatensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Comamonadaceae: N E > Delftia: N E > Delftia tsuruhatensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AY940090, FJ601374
2 UniProt : Q58LX7, C0KGM5
2 UniProt : Q58LX7, C0KGM5
2 Interpro : Q58LX7, C0KGM5
2 Prodom : Q58LX7, C0KGM5
2 Pfam : Q58LX7, C0KGM5
2 PIRSF : Q58LX7, C0KGM5
2 SUPERFAM : Q58LX7, C0KGM5
Sequence
Graphical view for this peptide sequence: 9burk-q58lx7
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MSTTSSNPEIGHSIEAAGIRTNYHDSGAQGAPVLLIHGSGPGVSAWANWR
LVMPALAQNARVIAPDMVGFGYSDRPQGFAYGMDAWVRQAVGLLDALGIE
RTDLVGNSFGGGLALALAIRHPERVRRLVLMGSVGVSFPITEGLDAVWGY
TPSVENMRSIMDYFAFNKGLMSDDLARLRFEASARPGVQESYAAMFPAPR
QRWVDAMASREEDIRALPHQTLLVHGRDDRVIPLSTSLTLSSWIARSQLH
VYGQCGHWTQIEHAARFARLVGDFLAEASADEPQPL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSTTSSNPEIGHSIEAAGIRTNYHDSGAQGAPVLLIHGSGPGVSAWANWR
LVMPALAQNARVIAPDMVGFGYSDRPQGFAYGMDAWVRQAVGLLDALGIE
RTDLVGNSFGGGLALALAIRHPERVRRLVLMGSVGVSFPITEGLDAVWGY
TPSVENMRSIMDYFAFNKGLMSDDLARLRFEASARPGVQESYAAMFPAPR
QRWVDAMASREEDIRALPHQTLLVHGRDDRVIPLSTSLTLSSWIARSQLH
VYGQCGHWTQIEHAARFARLVGDFLAEASADEPQPL


Reference
    Title: A novel degradation pathway of chloroaniline in Diaphorobacter sp. PCA039 entails initial hydroxylation.
    Zhang T, Ren HF, Liu Y, Zhu BL, Liu ZP, Liu SJ
    Ref: World J Microbiol Biotechnol, 26:665, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer