Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9cucu-ACHE1

Propylea japonica acetylcholinesterase 1 (Ace1)

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Propylea japonica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Coleoptera: N E > Polyphaga: N E > Cucujiformia: N E > Cucujoidea: N E > Coccinellidae: N E > Coccinellinae: N E > Coccinellini: N E > Propylea: N E > Propylea japonica: N E


Molecular evidence
Database
1 mutation: 9cucu-ACHE1
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KP403801
1 UniProt : A0A1L1ZYE6
2 UniProt : A0A1L1ZYE6, A0A1L2FU40
2 Interpro : A0A1L1ZYE6, A0A1L2FU40
2 Prodom : A0A1L1ZYE6, A0A1L2FU40
2 Pfam : A0A1L1ZYE6, A0A1L2FU40
2 PIRSF : A0A1L1ZYE6, A0A1L2FU40
2 SUPERFAM : A0A1L1ZYE6, A0A1L2FU40
Sequence
Graphical view for this peptide sequence: 9cucu-ACHE1
Colored MSA for ACHE (raw)
MTTPWVACFLVIFALSPCIPQPHRNRHHLPEPHAEAYHMARDPFDPHRDS
EEFRRDAPDDKRDFSHKDNKGEDSLVIQTKKGKVKGITISAATGKKVGAW
MGIPYAQKPIGNLRFRHPRPVEAWEGILNATSQPNSCVQIIDTVFGDFPG
ATMWNPNTPLSEDCLYINVVVPKPRPTKAAVLVWIFGGGFYSGTNTLDVY
DHNILVSEENIILVSMQYRVASLGFLYFGTPDVPGNAGMFDQMMALQWVR
DNIAAFGGNPNNITLFGESAGAVSVSLHLLSPLSRNLFSQAIMESGSATA
PWAIISREESILRGLRLAEAVQCPHERSQLGAVIECLKKKDPTELVNNEW
GTLGICEFPFVPVIDGAFLDEHPVRAMSNKNFKKTNILMGSNTEEGYYFI
IYYLTELFRKEENVYVNRQEFLRAVTELNPYFSAVARQAIVFEYTDWLNP
DDPVSNRDALDKMVGDYHFTCNVNEFAHRYAETGNNVYMYYYKHRTVANP
WPSWTGVMHADEINYVFGEPLNPTKSYTNQEVDLSRRIMRYWANFAKTGN
PSLSPNGVWTPTFWPLHTAFGREYLTLDINSTATGRGPRLKQCAFWKKYL
PQLQQLTDELQNTPTKKNCTETSEAVSRRASLGTIVFILLFSGII
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTTPWVACFLVIFALSPCIPQPHRNRHHLPEPHAEAYHMARDPFDPHRDS
EEFRRDAPDDKRDFSHKDNKGEDSLVIQTKKGKVKGITISAATGKKVGAW
MGIPYAQKPIGNLRFRHPRPVEAWEGILNATSQPNSCVQIIDTVFGDFPG
ATMWNPNTPLSEDCLYINVVVPKPRPTKAAVLVWIFGGGFYSGTNTLDVY
DHNILVSEENIILVSMQYRVASLGFLYFGTPDVPGNAGMFDQMMALQWVR
DNIAAFGGNPNNITLFGESAGAVSVSLHLLSPLSRNLFSQAIMESGSATA
PWAIISREESILRGLRLAEAVQCPHERSQLGAVIECLKKKDPTELVNNEW
GTLGICEFPFVPVIDGAFLDEHPVRAMSNKNFKKTNILMGSNTEEGYYFI
IYYLTELFRKEENVYVNRQEFLRAVTELNPYFSAVARQAIVFEYTDWLNP
DDPVSNRDALDKMVGDYHFTCNVNEFAHRYAETGNNVYMYYYKHRTVANP
WPSWTGVMHADEINYVFGEPLNPTKSYTNQEVDLSRRIMRYWANFAKTGN
PSLSPNGVWTPTFWPLHTAFGREYLTLDINSTATGRGPRLKQCAFWKKYL
PQLQQLTDELQNTPTKKNCTETSEAVSRRASLGTIVFILLFSGII


Reference
    Title: Identification and characterization of ace1-type acetylcholinesterase in insecticide-resistant and -susceptible Propylaea japonica (Thunberg)
    Wang MM, Xing LY, Ni ZW, Wu G
    Ref: Bull Entomol Res, :1, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer