Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9delt-q0ylf6

Geobacter sp. FRC-32 putative enzyme precursor

Relationship
Family|ABHD13-BEM46
Block| X
Position in NCBI Life Tree|Geobacter sp. FRC-32
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > delta/epsilon subdivisions: N E > Deltaproteobacteria: N E > Desulfuromonadales: N E > Geobacteraceae: N E > Geobacter: N E > Geobacter daltonii: N E > Geobacter daltonii FRC-32: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : WP_012648332, ACM21604
1 UniProt : B9M4S0
1 Interpro : B9M4S0
1 Pfam : B9M4S0
1 PIRSF : B9M4S0
1 SUPERFAM : B9M4S0
Sequence
Graphical view for this peptide sequence: 9delt-q0ylf6
Colored MSA for ABHD13-BEM46 (raw)
MTKILLLVLLIALTVLCQGCVGRLFYYPDKETYDTPARHGLPFEEVTFAS
KDGTRLSGWFIPAVGKPKGTVIHFHGNAQNMTAHFGFVSWLPAEGFNLFV
FDYRGYGKSAGRPNRQGVFEDSVAAISYIAARKDVDQNRLLILGQSLGGT
NAIAAVGMNRFTGIRAVAIESTFASYREIVRDKIGEIPIVSLFKWPLSYL
LVGNSHSADQVVDKIAPLPLLLIYGDEDPIIPYRHGKKLFEKAKEPKQFW
TIKGGSHTEAFLEAGSPYRAKLVSFFLESLDGKLKIPK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTKILLLVLLIALTVLCQGCVGRLFYYPDKETYDTPARHGLPFEEVTFAS
KDGTRLSGWFIPAVGKPKGTVIHFHGNAQNMTAHFGFVSWLPAEGFNLFV
FDYRGYGKSAGRPNRQGVFEDSVAAISYIAARKDVDQNRLLILGQSLGGT
NAIAAVGMNRFTGIRAVAIESTFASYREIVRDKIGEIPIVSLFKWPLSYL
LVGNSHSADQVVDKIAPLPLLLIYGDEDPIIPYRHGKKLFEKAKEPKQFW
TIKGGSHTEAFLEAGSPYRAKLVSFFLESLDGKLKIPK



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer