Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9delt-q1nnp6

delta proteobacterium MLMS-1 hypothetical protein

Relationship
Family|ABHD13-BEM46
Block| X
Position in NCBI Life Tree|delta proteobacterium MLMS-1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > delta/epsilon subdivisions: N E > Deltaproteobacteria: N E > unclassified Deltaproteobacteria: N E > unclassified Deltaproteobacteria (miscellaneous): N E > delta proteobacterium MLMS-1: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AAQF01000136
Sequence
Graphical view for this peptide sequence: 9delt-q1nnp6
Colored MSA for ABHD13-BEM46 (raw)
MTMRLLLYLLSFAALIYLVGGLLLFLFQERLVHLPHLPGRAITATPGELG
LEWRDIEIVSEDGVRLHGWHIPGPEGAPTVLFFHGNAGNISHRLDTVQIL
HELGLEVVLFDYRGYGRSQGRAREAGLHRDARAAADWLYDTLGADPARTI
YHGRSLGGALAASAARHRPPAALVLESTLLSAREAAADLYPIYPTGLLTR
LQYATADYLREVPRPALIIHSPDDEIIPFRHGENLARIAGQHGELLPIHG
DHNRGFLASGTLYTNGLRDFIARHIEQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTMRLLLYLLSFAALIYLVGGLLLFLFQERLVHLPHLPGRAITATPGELG
LEWRDIEIVSEDGVRLHGWHIPGPEGAPTVLFFHGNAGNISHRLDTVQIL
HELGLEVVLFDYRGYGRSQGRAREAGLHRDARAAADWLYDTLGADPARTI
YHGRSLGGALAASAARHRPPAALVLESTLLSAREAAADLYPIYPTGLLTR
LQYATADYLREVPRPALIIHSPDDEIIPFRHGENLARIAGQHGELLPIHG
DHNRGFLASGTLYTNGLRDFIARHIEQ



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer