Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9entr-d4bdc1

Citrobacter youngae ATCC 29220 Citrobacter sp. 2-hydroxy-6-oxonona-2,4-diene-1,9-dioic acid 5,6-hydrolase

Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Citrobacter youngae ATCC 29220
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Citrobacter: N E > Citrobacter freundii complex: N E > Citrobacter youngae: N E > Citrobacter youngae ATCC 29220: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : ABWL02000009, GG657366
1 UniProt : D4BDC1
1 UniProt : D4BDC1
1 Interpro : D4BDC1
1 Prodom : D4BDC1
1 Pfam : D4BDC1
1 PIRSF : D4BDC1
1 SUPERFAM : D4BDC1
Sequence
Graphical view for this peptide sequence: 9entr-d4bdc1
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MQEKKMTYQPQTEAATSRFLEVQEAGETLRVHFNDCGQGEETVVLLHGSG
PGATGWANFSRNIDPLVEAGYRVILLDCPGWGKSDGIVNRGSRSDLNARI
LKSVVDRLDIQKIHLLGNSMGGHSAVAFTLSWPERVGKLVLMGGGTGGMS
LFTPMPTEGIKRLNQLYREPTIENLKLMMEIFVFDTSDLTEALFEARLNN
MLSRRDHLENFVQSLEANPKQFPDFSPRLGEIKAQTLIVWGRNDRFVPMD
AGLRLLSGITGSELHIYRDCGHWAQWEHADAFNQLVLNFLARP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQEKKMTYQPQTEAATSRFLEVQEAGETLRVHFNDCGQGEETVVLLHGSG
PGATGWANFSRNIDPLVEAGYRVILLDCPGWGKSDGIVNRGSRSDLNARI
LKSVVDRLDIQKIHLLGNSMGGHSAVAFTLSWPERVGKLVLMGGGTGGMS
LFTPMPTEGIKRLNQLYREPTIENLKLMMEIFVFDTSDLTEALFEARLNN
MLSRRDHLENFVQSLEANPKQFPDFSPRLGEIKAQTLIVWGRNDRFVPMD
AGLRLLSGITGSELHIYRDCGHWAQWEHADAFNQLVLNFLARP



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer