Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9euka-a8y7q7

Plasmodiophora brassicae Putative uncharacterized protein

Relationship
Family|Prolylcarboxypeptidase
Block| X
Position in NCBI Life Tree|Plasmodiophora brassicae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Rhizaria: N E > Cercozoa: N E > Imbricatea: N E > Plasmodiophorida: N E > Plasmodiophoridae: N E > Plasmodiophora: N E > Plasmodiophora brassicae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AM411657, AM411666, GU082362
2 UniProt : A8Y7Q7, D0VMQ7
2 UniProt : A8Y7Q7, D0VMQ7
2 Interpro : A8Y7Q7, D0VMQ7
2 Prodom : A8Y7Q7, D0VMQ7
2 Pfam : A8Y7Q7, D0VMQ7
2 PIRSF : A8Y7Q7, D0VMQ7
2 SUPERFAM : A8Y7Q7, D0VMQ7
Sequence
Graphical view for this peptide sequence: 9euka-a8y7q7
Colored MSA for Prolylcarboxypeptidase (raw)
MMRIALWAIAYLAWQGHAYVQTEHVFPDQLVDHTAIGGGGARFSQRYFRI
DQFWSGPDGPVILQLCGEYTCAGVTDGRQFPSALAERYGALVLVLEHRYF
GKSSPFSVLSPRNLTYLTTFQALSDIACFTDWYQRVHIGRANANKWITIG
GSYPGALAAWYRLKYPHLTAGALASSAVVAPFAEFPEFDEQVALSAGPEC
THALQDITAMVEGALQEGGRLADEMNALFSCSQLSDADFLYLIADAMAEA
IQYGPSVSLCDPIVQAESRDDRLAAFVEFVQGTFYASMSNSPGDYDGDTM
ASHRWVPDSSGRQWWWMKCNEVGWFQIAPGTNSIRSKRVNMEWHRDRCEK
LFGDVLAFPPPCHRASIEYSGFDMSVSNVVFTNGVEDPWQWAGASAFSSS
AHLRDSSVLLINCSQCGHCVDLHTPSPDDAPALTTARSTIIAHIDRWLIG
SALQVDLGSSAVPKAIL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMRIALWAIAYLAWQGHAYVQTEHVFPDQLVDHTAIGGGGARFSQRYFRI
DQFWSGPDGPVILQLCGEYTCAGVTDGRQFPSALAERYGALVLVLEHRYF
GKSSPFSVLSPRNLTYLTTFQALSDIACFTDWYQRVHIGRANANKWITIG
GSYPGALAAWYRLKYPHLTAGALASSAVVAPFAEFPEFDEQVALSAGPEC
THALQDITAMVEGALQEGGRLADEMNALFSCSQLSDADFLYLIADAMAEA
IQYGPSVSLCDPIVQAESRDDRLAAFVEFVQGTFYASMSNSPGDYDGDTM
ASHRWVPDSSGRQWWWMKCNEVGWFQIAPGTNSIRSKRVNMEWHRDRCEK
LFGDVLAFPPPCHRASIEYSGFDMSVSNVVFTNGVEDPWQWAGASAFSSS
AHLRDSSVLLINCSQCGHCVDLHTPSPDDAPALTTARSTIIAHIDRWLIG
SALQVDLGSSAVPKAIL


Reference
    Title: Intron-rich gene structure in the intracellular plant parasite Plasmodiophora brassicae
    Bulman S, Ridgway HJ, Eady C, Conner AJ
    Ref: Protist, 158:423, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer