Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9eury-c1v4p7

Halogeometricum borinquense DSM 11551 Predicted esterase

Comment
Other strains: Halogeometricum borinquense (strain ATCC 700274 / DSM 11551 / JCM 10706 / KCTC 4070 / PR3)


Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Halogeometricum borinquense DSM 11551
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > Euryarchaeota: N E > Halobacteria: N E > Haloferacales: N E > Haloferacaceae: N E > Halogeometricum: N E > Halogeometricum borinquense: N E > Halogeometricum borinquense DSM 11551: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : ABTX01000001, WP_006053803
1 UniProt : A0A482TDM9
1 Interpro : A0A482TDM9
1 Pfam : A0A482TDM9
1 PIRSF : A0A482TDM9
1 SUPERFAM : A0A482TDM9
Sequence
Graphical view for this peptide sequence: 9eury-c1v4p7
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MSAADPHADQPILTGGTEPEDAEAVVVLVHGRGATARGMLAFADEFHDDG
VHYVAPQAQRGTWYPNSFMAPTESNQPHYQSALLHLNRAVEQARETTGLD
DEKIIFVGFSQGACLASSYVAQHPSRYGGVVLLSGGFVGPEGAAFDFEGS
MAGTPVFLGVSDDDPHVPQSRAEETIAAFDRMDADTRFDLYEGRGHGIFP
EEIEYLRTLVASVLP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSAADPHADQPILTGGTEPEDAEAVVVLVHGRGATARGMLAFADEFHDDG
VHYVAPQAQRGTWYPNSFMAPTESNQPHYQSALLHLNRAVEQARETTGLD
DEKIIFVGFSQGACLASSYVAQHPSRYGGVVLLSGGFVGPEGAAFDFEGS
MAGTPVFLGVSDDDPHVPQSRAEETIAAFDRMDADTRFDLYEGRGHGIFP
EEIEYLRTLVASVLP


Reference
    Title: Complete genome sequence of Halogeometricum borinquense type strain (PR3)
    Malfatti S, Tindall BJ, Schneider S, Fahnrich R, Lapidus A, Labuttii K, Copeland A, Glavina Del Rio T, Nolan M and Chain P <21 more author(s)>
    Ref: Stand Genomic Sci, 1:150, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer