Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9firm-Est1E

Butyrivibrio proteoclasticus (strain ATCC 51982 / DSM 14932 / B316) (Clostridium proteoclasticum) Promiscuous Feruloyl Esterase (Est1E) from the Rumen Bacterium

Relationship
Family|AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Butyrivibrio Proteoclasticus B316
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Clostridia: N E > Clostridiales: N E > Lachnospiraceae: N E > Butyrivibrio: N E > Butyrivibrio proteoclasticus: N E > Butyrivibrio proteoclasticus B316: N E


Molecular evidence
Database
2 Genbank : CP001810, YP_003832182.1
1 UniProt : E0S0B3
1 Ncbi-nid : 302672222
1 Ncbi-pid : 302669374
2 Structure : 2WTM, 2WTN
1 UniProt : E0S0B3
1 Interpro : E0S0B3
1 Prodom : E0S0B3
1 Pfam : E0S0B3
1 PIRSF : E0S0B3
1 SUPERFAM : E0S0B3
Sequence
Graphical view for this peptide sequence: 9firm-Est1E
Colored MSA for AlphaBeta_hydrolase (raw)
SGAMYIDCDGIKLNAYLDMPKNNPEKCPLCIIIHGFTGHSEERHIVAVQE
TLNEIGVATLRADMYGHGKSDGKFEDHTLFKWLTNILAVVDYAKKLDFVT
DIYMAGHSQGGLSVMLAAAMERDIIKALIPLSPAAMIPEIARTGELLGLK
FDPENIPDELDAWDGRKLKGNYVRVAQTIRVEDFVDKYTKPVLIVHGDQD
EAVPYEASVAFSKQYKNCKLVTIPGDTHCYDHHLELVTEAVKEFMLEQIA
K
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

SGAMYIDCDGIKLNAYLDMPKNNPEKCPLCIIIHGFTGHSEERHIVAVQE
TLNEIGVATLRADMYGHGKSDGKFEDHTLFKWLTNILAVVDYAKKLDFVT
DIYMAGHSQGGLSVMLAAAMERDIIKALIPLSPAAMIPEIARTGELLGLK
FDPENIPDELDAWDGRKLKGNYVRVAQTIRVEDFVDKYTKPVLIVHGDQD
EAVPYEASVAFSKQYKNCKLVTIPGDTHCYDHHLELVTEAVKEFMLEQIA
K


Reference
    Title: Structural and functional characterization of a promiscuous feruloyl esterase (Est1E) from the rumen bacterium Butyrivibrio proteoclasticus
    Goldstone DC, Villas-Boas SG, Till M, Kelly WJ, Attwood GT, Arcus VL
    Ref: Proteins, 78:1457, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer