Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9firm-c3rl82.1

Coprobacillus sp. D7 Clostridium ramosum DSM 1402 Putative uncharacterized protein

Comment
double gene Esterase 244 461 Esterase 654 864


Relationship
Family|A85-Feruloyl-Esterase
Block| X
Position in NCBI Life Tree|Coprobacillus sp. D7
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Erysipelotrichia: N E > Erysipelotrichales: N E > Erysipelotrichaceae: N E > Coprobacillus: N E > Coprobacillus sp. D7: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : EQ999881, ABFX02000008
1 UniProt : B0N7A0
1 UniProt : B0N7A0
1 Interpro : B0N7A0
1 Pfam : B0N7A0
1 PIRSF : B0N7A0
1 SUPERFAM : B0N7A0
Sequence
Graphical view for this peptide sequence: 9firm-c3rl82.1
Colored MSA for A85-Feruloyl-Esterase (raw)
MKAACIKECGVLIPSSDRMLVKGRDNMNKKNLLLSVALSGTMLMSNGITA
LTAQNAVYSPGVTVEKNTNPDWDADYTATFVYEDKDARDAERVTVSGNFQ
FYSLNDPVVKNYEKTADPTGAKVYSAYDYDKDNAMFNVSGGQNNDTPIYE
LEETGDERFEITLPLPGNQYFYDYTVEYSDGSKVTIQDPVNPSKKNSLTD
HDSGHSVFYVGNSENTTAGQEYIYPRADGQTGKYEFIEYKDAHNTDEETQ
SLGVYLPYNYDPSKTYKTIYVSHGGGGNEAEWMEIGSLPNIMDNILAEKE
AAESVVVTMDNSHFGWDYDLIAKNFKENIIPLIEERYSVSTKVEDRALCG
LSMGALTTGTIMFSYTDMFGAYGNFSGTADPLICKDWELLKTKTVYLTGG
NLDMAIQATQESGDSAFNRGKTVRAHEYLEELGVEHFYDLKYGSHDWGVW
RDAFTTFVKDILWGYEYPGESTYQAGVTVEENINPAYDGDYITTFVYEDQ
DIKDAVKVTVSGNLQFYSKDDEAVKNYTQTLDFSQAKVYNAYEYKDGMFN
TGYGLNNDTAI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKAACIKECGVLIPSSDRMLVKGRDNMNKKNLLLSVALSGTMLMSNGITA
LTAQNAVYSPGVTVEKNTNPDWDADYTATFVYEDKDARDAERVTVSGNFQ
FYSLNDPVVKNYEKTADPTGAKVYSAYDYDKDNAMFNVSGGQNNDTPIYE
LEETGDERFEITLPLPGNQYFYDYTVEYSDGSKVTIQDPVNPSKKNSLTD
HDSGHSVFYVGNSENTTAGQEYIYPRADGQTGKYEFIEYKDAHNTDEETQ
SLGVYLPYNYDPSKTYKTIYVSHGGGGNEAEWMEIGSLPNIMDNILAEKE
AAESVVVTMDNSHFGWDYDLIAKNFKENIIPLIEERYSVSTKVEDRALCG
LSMGALTTGTIMFSYTDMFGAYGNFSGTADPLICKDWELLKTKTVYLTGG
NLDMAIQATQESGDSAFNRGKTVRAHEYLEELGVEHFYDLKYGSHDWGVW
RDAFTTFVKDILWGYEYPGESTYQAGVTVEENINPAYDGDYITTFVYEDQ
DIKDAVKVTVSGNLQFYSKDDEAVKNYTQTLDFSQAKVYNAYEYKDGMFN
TGYGLNNDTAI



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer