Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9firm-d6hmk8

Erysipelotrichaceae bacterium 5_2_54FAA Putative hydrolase, alpha/beta hydrolase fold family

Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Erysipelotrichaceae bacterium 5_2_54FAA
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Erysipelotrichia: N E > Erysipelotrichales: N E > Erysipelotrichaceae: N E > unclassified Erysipelotrichaceae: N E > unclassified Erysipelotrichaceae (miscellaneous): N E > Erysipelotrichaceae bacterium 5_2_54FAA: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : GG749078
Sequence
Graphical view for this peptide sequence: 9firm-d6hmk8
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MVPDREVVGVIQLVHGMAEHKERYENLMHYLAQSGYLCVIHDHRGHGESV
KSQADLGYFYGVDATYLIEDIHEISMRIKEHFPHVPLFLFGHSMGSLAVR
AYCKRYDRDIDGLIVCGSPSENKAAAFGKILCQIMEKVKQDHYRSSLLQR
LAFGHHNDGIQDAKSENSWICSDEDVVKEYDEDPLCGFTFTLNGFENLFA
LMMTVYDKKGWRCHHASIPIYFIAGKQDPCIISEKAFHTAVMLMRKVGYA
NVSWKLYEGMRHEILNERDKGEVYRDLLKWLNKHTTNT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVPDREVVGVIQLVHGMAEHKERYENLMHYLAQSGYLCVIHDHRGHGESV
KSQADLGYFYGVDATYLIEDIHEISMRIKEHFPHVPLFLFGHSMGSLAVR
AYCKRYDRDIDGLIVCGSPSENKAAAFGKILCQIMEKVKQDHYRSSLLQR
LAFGHHNDGIQDAKSENSWICSDEDVVKEYDEDPLCGFTFTLNGFENLFA
LMMTVYDKKGWRCHHASIPIYFIAGKQDPCIISEKAFHTAVMLMRKVGYA
NVSWKLYEGMRHEILNERDKGEVYRDLLKWLNKHTTNT



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer