Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9flao-q1vsa7

Psychroflexus torquis (strain ATCC 700755 / ACAM 623) phospholipase/carboxylesterase family protein

Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Psychroflexus torquis ATCC 700755
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Bacteroidetes: N E > Flavobacteriia: N E > Flavobacteriales: N E > Flavobacteriaceae: N E > Psychroflexus: N E > Psychroflexus torquis: N E > Psychroflexus torquis ATCC 700755: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AFU70485, WP_015026018
1 UniProt : K4IYF6
1 UniProt : K4IYF6
1 Interpro : K4IYF6
1 Pfam : K4IYF6
1 PIRSF : K4IYF6
1 SUPERFAM : K4IYF6
Sequence
Graphical view for this peptide sequence: 9flao-q1vsa7
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MTTKDLSLTHLVRPSSLPDNAPLILMLHGYGSNENDLFSFANELPEEYIV
ISLKAPHAMQPSGNAWYAINFDAQKGKFSDIEQAVLSRKLVKTFLEEAIE
AYPIDKSKVSLLGFSQGTILSFALALSYPEVFKNVIGLSGYVDINMIEAG
YESKDFSHLKVYNSHGSEDQVIPVDWARQNKPLLDKLNIDTIYEEYPEGH
GINPQNFQSLKNWLKAQH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTTKDLSLTHLVRPSSLPDNAPLILMLHGYGSNENDLFSFANELPEEYIV
ISLKAPHAMQPSGNAWYAINFDAQKGKFSDIEQAVLSRKLVKTFLEEAIE
AYPIDKSKVSLLGFSQGTILSFALALSYPEVFKNVIGLSGYVDINMIEAG
YESKDFSHLKVYNSHGSEDQVIPVDWARQNKPLLDKLNIDTIYEEYPEGH
GINPQNFQSLKNWLKAQH



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer