Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-a0a1b1ijp3

Psychrobacter sp. Lipase ZC12

Comment
Other strains: Psychrobacter sp. 4Bb


Relationship
Family|Bacterial_lip_FamI.1
Block| L
Position in NCBI Life Tree|Psychrobacter sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Psychrobacter: N E > Psychrobacter sp.: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : ANR94963
1 UniProt : A0A1B1IJP3
1 UniProt : A0A1B1IJP3
1 Interpro : A0A1B1IJP3
1 Prodom : A0A1B1IJP3
1 Pfam : A0A1B1IJP3
1 PIRSF : A0A1B1IJP3
1 SUPERFAM : A0A1B1IJP3
Sequence
Graphical view for this peptide sequence: 9gamm-a0a1b1ijp3
Colored MSA for Bacterial_lip_FamI.1 (raw)
MTLSLYIRAALTPKTLLPILGSISAGVLLMTIQTTSAQAAGQYYNCANAN
GCKLVDSKYFTSSYTKTQYPVVLAHGLGGFTTLFGVIDYFNGIPEDLMKG
GSEVYTTKTSAVNNSEVRGEQLLQQVKTIAAISGESKVNLFGHSQGGIDI
RYVAGVAPKYVASVTAVSSPEQGSKTADFVKNVLEPNNTSGQPSNVTTQL
VSGVFNLIGGFTDIGSGISFNQIQQQDGWQALVALSTDGAAKFNAKFPAA
MPKNYCGQPTSTAVNGIKYYSFSGVGQITSALDPSDYLLAATGVPFAGES
NDGLVSACSSRLGYVIRDNYRMNHLDSADQVLGLTAWGESEPKSIYRTQV
NRLKNANL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTLSLYIRAALTPKTLLPILGSISAGVLLMTIQTTSAQAAGQYYNCANAN
GCKLVDSKYFTSSYTKTQYPVVLAHGLGGFTTLFGVIDYFNGIPEDLMKG
GSEVYTTKTSAVNNSEVRGEQLLQQVKTIAAISGESKVNLFGHSQGGIDI
RYVAGVAPKYVASVTAVSSPEQGSKTADFVKNVLEPNNTSGQPSNVTTQL
VSGVFNLIGGFTDIGSGISFNQIQQQDGWQALVALSTDGAAKFNAKFPAA
MPKNYCGQPTSTAVNGIKYYSFSGVGQITSALDPSDYLLAATGVPFAGES
NDGLVSACSSRLGYVIRDNYRMNHLDSADQVLGLTAWGESEPKSIYRTQV
NRLKNANL


Reference
    Title: Self-assembly of lipase hybrid nanoflowers with bifunctional Ca(2+) for improved activity and stability
    Zhang Y, Sun W, Elfeky NM, Wang Y, Zhao D, Zhou H, Wang J, Bao Y
    Ref: Enzyme Microb Technol, 132:109408, 2020 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer