Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-a9d1i5

Shewanella benthica KT99 Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12) Putative uncharacterized protein

Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Shewanella benthica KT99
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Alteromonadales: N E > Shewanellaceae: N E > Shewanella: N E > Shewanella benthica: N E > Shewanella benthica KT99: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : ABIC01000006, AP011177
2 UniProt : A9D1I5, D4ZFN1
2 UniProt : A9D1I5, D4ZFN1
2 Interpro : A9D1I5, D4ZFN1
2 Pfam : A9D1I5, D4ZFN1
2 PIRSF : A9D1I5, D4ZFN1
2 SUPERFAM : A9D1I5, D4ZFN1
Sequence
Graphical view for this peptide sequence: 9gamm-a9d1i5
Colored MSA for abh_upf0017 (raw)
MMRHFSPPWWARNPHVQTILPVLTKVDRPDLTRQRLELSDGDFIDLDWLS
QPKAHQPIVIIIHGLEGSSESHYVRRLLNDCHRQSICAVVHHHRSCSGET
NRKARSYHSGDTQDLQENLSQLKLKYPDSPLLAVGYSLGGNVLTKYLGEY
ANASLIERAVVISAPLQLSACAKRLASGFSKVYQSYLIKQLQQKTTAKVK
NPQLAQDMPVSLSQIPQLQTFYDFDHRVTAPLHGFDSVDDYYQRASGMDF
LQYIHKPTLVIHAADDPFMTADVIPTAEQCASQVTYELHSQGGHVGFIDG
GTPFKPRYYLEQRILHFLISQEA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMRHFSPPWWARNPHVQTILPVLTKVDRPDLTRQRLELSDGDFIDLDWLS
QPKAHQPIVIIIHGLEGSSESHYVRRLLNDCHRQSICAVVHHHRSCSGET
NRKARSYHSGDTQDLQENLSQLKLKYPDSPLLAVGYSLGGNVLTKYLGEY
ANASLIERAVVISAPLQLSACAKRLASGFSKVYQSYLIKQLQQKTTAKVK
NPQLAQDMPVSLSQIPQLQTFYDFDHRVTAPLHGFDSVDDYYQRASGMDF
LQYIHKPTLVIHAADDPFMTADVIPTAEQCASQVTYELHSQGGHVGFIDG
GTPFKPRYYLEQRILHFLISQEA


Reference
    Title: Complete genome sequence and comparative analysis of Shewanella violacea, a psychrophilic and piezophilic bacterium from deep sea floor sediments
    Aono E, Baba T, Ara T, Nishi T, Nakamichi T, Inamoto E, Toyonaga H, Hasegawa M, Takai Y and Mori H <6 more author(s)>
    Ref: Mol Biosyst, 6:1216, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer