(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Proteobacteria: NE > Gammaproteobacteria: NE > Alteromonadales: NE > Idiomarinaceae: NE > Idiomarina: NE > Idiomarina sp. A28L: NE
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MAIFVFAHGAGAGPESEFMQAISANLEQKGHKVHRFAFPYWQIIEQSGKK RPPDKQNVLDAAFIDEVAKVRKGSEDIPLVVMGKSMGARVAFRCADSVNA VAAIGLGFPFHPPGKQEKHRLAELENSRKRNFVVHGTSDPFGKPEWLAEQ TLPKNLKMHWVEGGNHDLSRPKRSGLTNTESWQLVSREIDAFVTKLIK
Reference
Title: Genome sequence of Idiomarina sp. strain A28L, isolated from Pangong Lake, India Gupta HK, Singh A, Sharma R Ref: Journal of Bacteriology, 193:5875, 2011 : PubMed
Idiomarina sp. strain A28L was isolated from the alkaline brackish water of a high-altitude lake, Pangong Lake. Here, we present the draft genome of Idiomarina sp. strain A28L, which contains 2,591,567 bp with a G+C content of 45.5 mol% and contains 2,299 protein-coding genes and 56 structural RNAs.