Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-v2vs02

Acinetobacter brisouii; Acinetobacter sp. Acinetobacter brisouii, Uncharacterized protein

Comment
Other strains: Acinetobacter brisouii CIP 110357; Acinetobacter sp. ANC 3789; Acinetobacter brisouii ANC 4119


Relationship
Family|abh_upf00227
Block| X
Position in NCBI Life Tree|Acinetobacter brisouii CIP 110357
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter brisouii: N E > Acinetobacter brisouii CIP 110357: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AYEU01000007, APOY01000008, APPR01000012
2 UniProt : V2VS02, N8U2S1
2 UniProt : V2VS02, N8U2S1
2 Interpro : V2VS02, N8U2S1
2 Pfam : V2VS02, N8U2S1
2 PIRSF : V2VS02, N8U2S1
2 SUPERFAM : V2VS02, N8U2S1
Sequence
Graphical view for this peptide sequence: 9gamm-v2vs02
Colored MSA for abh_upf00227 (raw)
MNIIYLHGFRSNAYSVKGQQLKRYCEAHCPSYSVHLPDLNMPPLEALAQV
AGYIQALENVVLVGSSLGGFYATHLALQYACPAVLINPAVHPYALFMRLF
GHGQIPLQVTPDWTLDQSQLQQLAAMDVPIVQDASKLLVLLQQGDEVLDY
REAQRYYNQAQTPSMIMTEMGGNHAMENFADKIPMLLTFLALSITKEK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNIIYLHGFRSNAYSVKGQQLKRYCEAHCPSYSVHLPDLNMPPLEALAQV
AGYIQALENVVLVGSSLGGFYATHLALQYACPAVLINPAVHPYALFMRLF
GHGQIPLQVTPDWTLDQSQLQQLAAMDVPIVQDASKLLVLLQQGDEVLDY
REAQRYYNQAQTPSMIMTEMGGNHAMENFADKIPMLLTFLALSITKEK



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer