Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9hyme-b7s8r4

Glyptapanteles flavicoxis, Glyptapanteles indiensis, Prolylcarboxypeptidase

Relationship
Family|Prolylcarboxypeptidase
Block| X
Position in NCBI Life Tree|Glyptapanteles flavicoxis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Hymenoptera: N E > Apocrita: N E > Terebrantes: N E > Ichneumonoidea: N E > Braconidae: N E > Microgastrinae: N E > Glyptapanteles: N E > Glyptapanteles flavicoxis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : EF710650, EF710656
2 UniProt : B7S8R4, B7S900
2 UniProt : B7S8R4, B7S900
2 Interpro : B7S8R4, B7S900
2 Prodom : B7S8R4, B7S900
2 Pfam : B7S8R4, B7S900
2 PIRSF : B7S8R4, B7S900
2 SUPERFAM : B7S8R4, B7S900
Sequence
Graphical view for this peptide sequence: 9hyme-b7s8r4
Colored MSA for Prolylcarboxypeptidase (raw)
MDHKVYNFALLSFILIIQFIKLNSLQVITATIETTNSSSSPYKYVTKKFI
VPVDHFSFSLNNTFEMRYFVNDTWKSGKNAPIFFYTGNEGVLETFAANTG
FMWDIAPTFGALIVFAEHRYYGESMPFGNKSFDNVKNLGYLTSQQALADY
VDLIVHLKSDPSLKHSPVIAFGGSYGGMLSAWFRMKYPHIINGAIAASAP
VLQFTGYTDCQAFSRIVTSDFRAVHPNCEKVIRKSWESIKNLTSTDDGKK
WISTKFKVCGSLTTEENFKTFKDFLLSVYSNLAMVNYPYATDFLSPLPAF
PIREFCKFVNDTNLSSDKDVMTNLQKGINLYSNYTGRLKCLDLSDPEPDL
GAANGWNYQACTEMVMPMCNDGVNDMFEPEPWNFTKYSQDCFTHFNVTPK
PELVCDMYGCDDLSTASNIVFSNGLLDPWSSGGVLRNLSSSAVAIIIPEG
AHHLDLRGSHPSDPYSVVKAREYHAYSIKKWIREHREDLNNDPALGV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDHKVYNFALLSFILIIQFIKLNSLQVITATIETTNSSSSPYKYVTKKFI
VPVDHFSFSLNNTFEMRYFVNDTWKSGKNAPIFFYTGNEGVLETFAANTG
FMWDIAPTFGALIVFAEHRYYGESMPFGNKSFDNVKNLGYLTSQQALADY
VDLIVHLKSDPSLKHSPVIAFGGSYGGMLSAWFRMKYPHIINGAIAASAP
VLQFTGYTDCQAFSRIVTSDFRAVHPNCEKVIRKSWESIKNLTSTDDGKK
WISTKFKVCGSLTTEENFKTFKDFLLSVYSNLAMVNYPYATDFLSPLPAF
PIREFCKFVNDTNLSSDKDVMTNLQKGINLYSNYTGRLKCLDLSDPEPDL
GAANGWNYQACTEMVMPMCNDGVNDMFEPEPWNFTKYSQDCFTHFNVTPK
PELVCDMYGCDDLSTASNIVFSNGLLDPWSSGGVLRNLSSSAVAIIIPEG
AHHLDLRGSHPSDPYSVVKAREYHAYSIKKWIREHREDLNNDPALGV



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer