Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9list-e3yqw9

Listeria marthii FSL S4-120 Shchc synthase

Relationship
Family|MenH_SHCHC
Block| X
Position in NCBI Life Tree|Listeria marthii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Listeriaceae: N E > Listeria: N E > Listeria marthii: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : ADXF01000702
Sequence
Graphical view for this peptide sequence: 9list-e3yqw9
Colored MSA for MenH_SHCHC (raw)
MLVNGQHYYLKNSLSGDKPVLLMLHGFTGSSETFQNSISYLKEWYNIVAP
DLLGHGKTASPEEVARYSIQEICADLAQMLHQLKIAKCFVLGYSMGGRVA
TAFAAAYPEMVRGLVLVSSSPGLRQADVRASRVQADNRLADRIEAEGITS
FVDYWENLALFNSQSVLPAEQKKRIRSERLAQNPHGLAMSLRGMGTGKQP
SYWDKLAGFTFPVLLITGALDEKFEKIAQDMQQLLPNSTHVTVQEAGHAV
YLEQPNIFSSQLNNWLEVILKEEEK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLVNGQHYYLKNSLSGDKPVLLMLHGFTGSSETFQNSISYLKEWYNIVAP
DLLGHGKTASPEEVARYSIQEICADLAQMLHQLKIAKCFVLGYSMGGRVA
TAFAAAYPEMVRGLVLVSSSPGLRQADVRASRVQADNRLADRIEAEGITS
FVDYWENLALFNSQSVLPAEQKKRIRSERLAQNPHGLAMSLRGMGTGKQP
SYWDKLAGFTFPVLLITGALDEKFEKIAQDMQQLLPNSTHVTVQEAGHAV
YLEQPNIFSSQLNNWLEVILKEEEK


Reference
    Title: Comparative genomics of the bacterial genus Listeria: Genome evolution is characterized by limited gene acquisition and limited gene loss
    den Bakker HC, Cummings CA, Ferreira V, Vatta P, Orsi RH, Degoricija L, Barker M, Petrauskene O, Furtado MR, Wiedmann M
    Ref: BMC Genomics, 11:688, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer